Immunoprecipitation (IP)
(Immunoprecipitation of MAPRE2 transfected lysate using MAPRE2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with MAPRE2 mouse polyclonal antibody.)
Rabbit anti-Human MAPRE2 Polyclonal Antibody | anti-MAPRE2 antibody
MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-binding Protein 2, EB2, RP1)
Reactivity
Human
Applications
Immunoprecipitation
Purity
SerumSerum
Synonyms
MAPRE2; Polyclonal Antibody; MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2; APC-binding Protein EB2; End-binding Protein 2; EB2; RP1); Anti -MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2; anti-MAPRE2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MAPRE2.
Purity/Purification
Serum
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
Applicable Applications for anti-MAPRE2 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human MAPRE2, aa1-327 (NP_055083.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunoprecipitation (IP)
(Immunoprecipitation of MAPRE2 transfected lysate using MAPRE2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with MAPRE2 mouse polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of MAPRE2 transfected lysate using MAPRE2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with MAPRE2 mouse polyclonal antibody.)
Related Product Information for anti-MAPRE2 antibody
May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
Product Categories/Family for anti-MAPRE2 antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
37,031 Da
NCBI Official Full Name
MAPRE2
UniProt Protein Name
Microtubule-associated protein RP/EB family member 2
Protein Family
UniProt Gene Name
MAPRE2
UniProt Synonym Gene Names
RP1; EB2
UniProt Entry Name
MARE2_HUMAN
Uniprot Description
RP1: shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. Its function is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR.
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 18q12.1
Cellular Component: microtubule cytoskeleton; cytoplasm
Molecular Function: microtubule binding
Biological Process: mitosis; cell proliferation; cell division; signal transduction
Similar Products
Product Notes
The MAPRE2 mapre2 (Catalog #AAA6006685) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-binding Protein 2, EB2, RP1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPRE2 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the MAPRE2 mapre2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGPTQTLSP NGENNNDIIQ DNNGTIIPFR KHTVRGERSY SWGMAVNVYS TSITQETMSR HDIIAWVNDI VSLNYTKVEQ LCSGAAYCQF MDMLFPGCIS LKKVKFQAKL EHEYIHNFKL LQASFKRMNV DKVIPVEKLV KGRFQDNLDF IQWFKKFYDA NYDGKEYDPV EARQGQDAIP PPDPGEQIFN LPKKSHHANS PTAGAAKSSP AAKPGSTPSR PSSAKRASSS GSASKSDKDL ETQVIQLNEQ VHSLKLALEG VEKERDFYFG KLREIELLCQ EHGQENDDLV QRLMDILYAS EEHEGHTEEP EAEEQAHEQQ PPQQEEY. It is sometimes possible for the material contained within the vial of "MAPRE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
