Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Mouse anti-Human MAPRE2 Monoclonal Antibody | anti-MAPRE2 antibody

MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-binding Protein 2, EB2, RP1) APC

Gene Names
MAPRE2; EB1; EB2; RP1; CSCSC2
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPRE2; Monoclonal Antibody; MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2; APC-binding Protein EB2; End-binding Protein 2; EB2; RP1) APC; anti-MAPRE2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D7
Specificity
Recognizes human MAPRE2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MAPRE2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 35ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-63 from human MAPRE2 (NP_055083) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB)

(MAPRE2 monoclonal antibody Western Blot analysis of MAPRE2 expression in K-562.)

Western Blot (WB) (MAPRE2 monoclonal antibody Western Blot analysis of MAPRE2 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody Lane 1: MAPRE2 transfected lysate (37kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody Lane 1: MAPRE2 transfected lysate (37kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPRE2 on HeLa cell. [antibody concentration 35ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAPRE2 on HeLa cell. [antibody concentration 35ug/ml].)
Product Categories/Family for anti-MAPRE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.2 kDa (347aa), confirmed by MALDI-TOF
NCBI Official Full Name
microtubule-associated protein RP/EB family member 2 isoform 1
NCBI Official Synonym Full Names
microtubule associated protein RP/EB family member 2
NCBI Official Symbol
MAPRE2
NCBI Official Synonym Symbols
EB1; EB2; RP1; CSCSC2
NCBI Protein Information
microtubule-associated protein RP/EB family member 2
UniProt Protein Name
Microtubule-associated protein RP/EB family member 2
UniProt Gene Name
MAPRE2
UniProt Synonym Gene Names
RP1; EB2
UniProt Entry Name
MARE2_HUMAN

NCBI Description

The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

RP1: shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. Its function is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 18q12.1

Cellular Component: microtubule cytoskeleton; cytoplasm

Molecular Function: microtubule binding

Biological Process: cell proliferation; mitosis; cell division; signal transduction

Research Articles on MAPRE2

Similar Products

Product Notes

The MAPRE2 mapre2 (Catalog #AAA6137523) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-binding Protein 2, EB2, RP1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPRE2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 35ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPRE2 mapre2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPRE2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.