Mouse MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody | anti-MAP3K1 antibody

MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody

Cat. Num. AAA439590

• Gene Names: MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
• Reactivity: Human. Others not known
• Applications: Flow Cytometry, Functional Assay, Immunofluorescence, Western Blot, Immunohistochemistry
• Synonyms: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1); Monoclonal Antibody; MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody; MEKK1; MEK Kinase 1; MEKK; SRXY6; MAPKKK1; anti-MAP3K1 antibody

• Host: Mouse
• Reactivity: Human. Others not known
• Clonality: Monoclonal
• Isotype: IgG2a, kappa
• Clone Number: 2F6
• Specificity: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF-kB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
• Form/Format: 200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
• Sequence Length: 1512

• Applicable Applications for anti-MAP3K1 antibody: Flow Cytometry (FC/FACS), Immunofluorescence (IF), Western Blot (WB), Immunohistochemistry (IHC) Formalin
• Application Notes: Western Blot (0.5-1ug/ml); Immunohistochemistry (Formalin-fixed) (0.5-1.0ug/ml for 30 minutes at RT) (Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes); Optimal dilution for a specific application should be determined.
• Cellular Localization: Cytoplasmic
• Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
• Hu-Chromosome Location: 5q11.2
• Positive Control: A431, HeLa or HL-60 cells or liver tissue.
• Preparation and Storage: Antibody with azide - store at 2 to 8 degree C. Antibody without azide - store at -20 to -80 degree C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Immunohistochemistry (IHC)

(Formalin-fixed, paraffin-embedded human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)

Immunohistochemistry (IHC)

(Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)

Immunohistochemistry (IHC)

(Formalin-fixed, paraffin-embedded human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)

References

Guan, K.L. 1994. The mitogen activated protein kinase signal transduction pathway: from the cell surface to the nucleus. Cell. Signal. 6: 581-589

NCBI and Uniprot Product Information

• NCBI GI #: 153945765
• NCBI GeneID: 4214
• NCBI Accession #: NP_005912.1
• NCBI GenBank Nucleotide #: NM_005921.1
• UniProt Accession #: Q13233
• Molecular Weight: 195kDa (intact); 80kDa (cleaved)
• NCBI Official Full Name: mitogen-activated protein kinase kinase kinase 1
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 1
• NCBI Official Symbol: MAP3K1
• NCBI Official Synonym Symbols: MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 1
• UniProt Protein Name: Mitogen-activated protein kinase kinase kinase 1
• UniProt Gene Name: MAP3K1
• UniProt Synonym Gene Names: MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1
• UniProt Entry Name: M3K1_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]

Uniprot Description

MEKK1: a protein kinase of the STE11 family. Phosphorylates and activates MKK4 and -7, which in turn activate JNK1, -2 and -3. Contains 1 RING-type zinc finger. The RING finger domain of MEKK1 exhibits E3 ubiquitin ligase activity toward c-Jun. c-Jun is downregulated in response to osmotic stress via ubiquitination-mediated degradation by the RING finger domain of MEKK1. Overexpressed/overactivated in multiple tumor types. The Mek1/2 inhibitor U0126 blocks export of influenza viral particles and has been suggested as an antiviral treatment. Single mutations at the same point of each gene also associated with cardiofaciocutaneous syndrome, (also linked with Braf and Kras mutations), displaying morphological, cardiac and mental defects. Inhibitors: U0126, CI-1040/PD184352, PD-0325901 (Phase I cancer), ARRY-142886 (Phase 1, cancer).

Protein type: Ubiquitin ligase; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, STE; Ubiquitin conjugating system; EC 2.7.11.25; Ligase; STE group; STE11 family

Chromosomal Location of Human Ortholog: 5q11.2

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; protein kinase activity; protein kinase binding; protein serine/threonine kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; MyD88-dependent toll-like receptor signaling pathway

Disease: 46,xy Sex Reversal 6