Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Mitogen-activated protein kinase kinase kinase 1 Recombinant Protein | MAP3K1 recombinant protein

Recombinant Mouse Mitogen-activated protein kinase kinase kinase 1 protein

Gene Names
MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitogen-activated protein kinase kinase kinase 1; Recombinant Mouse Mitogen-activated protein kinase kinase kinase 1 protein; MAPK/ERK kinase kinase 1; MAP3K1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
Applicable Applications for MAP3K1 recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for MAP3K1 recombinant protein
Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kd
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
NCBI Official Symbol
MAP3K1
NCBI Official Synonym Symbols
MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 1; MEK kinase 1; MAP/ERK kinase kinase 1; MAPK/ERK kinase kinase 1
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 1
UniProt Gene Name
MAP3K1
UniProt Synonym Gene Names
MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1
UniProt Entry Name
M3K1_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]

Uniprot Description

Function: Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway. Ref.2

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Cofactor: Magnesium.

Enzyme regulation: Activated by autophosphorylation on Thr-1400 and Thr-1412 following oligomerization.

Subunit structure: Binds both upstream activators and downstream substrates in multimolecular complexes through its N-terminus. Oligomerizes after binding MAP4K2 or TRAF2. Interacts with AXIN1. Interacts (via the kinase catalytic domain) with STK38. Ref.2 Ref.4 Ref.5 Ref.8

Post-translational modification: Autophosphorylated

By similarity.

Involvement in disease: 46,XY sex reversal 6 (SRXY6) [MIM:613762]: A disorder of sex development. Affected individuals have a 46,XY karyotype but present as phenotypically normal females.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.13

Sequence similarities: Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.Contains 1 protein kinase domain.Contains 1 RING-type zinc finger.Contains 1 SWIM-type zinc finger.

Research Articles on MAP3K1

Similar Products

Product Notes

The MAP3K1 map3k1 (Catalog #AAA719380) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Mitogen-activated protein kinase kinase kinase 1 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the MAP3K1 map3k1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QPYREDAEWL KGQQIGLGAF SSCYQAQDVG TGTLMAVKQV TYVRNTSSEQ EEVVEALREE IRMMGHLNHP NIIRMLGATC EKSNYNLFIE WMAGGSVAHL LSKYGAFKES VVINYTEQLL RGLSYLHENQ IIHRDVKGAN LLIDSTGQRL RIADFGAAAR LASKGTGAGE FQGQLLGTIA FMAPEVLRGQ QYGRSCDVWS VGCAIIEMAC AKPPWNAEKH SNHLALIFKI ASATTAPSIP SHLSPGLRDV ALRCLELQPQ DRPPSRELLK HPVFRTTW. It is sometimes possible for the material contained within the vial of "Mitogen-activated protein kinase kinase kinase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.