Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in human liver.)

Mouse anti-Human, Mouse MAGEA12 Monoclonal Antibody | anti-MAGEA12 antibody

MAGEA12 (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (AP)

Gene Names
MAGEA12; CT1.12; MAGE12
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAGEA12; Monoclonal Antibody; MAGEA12 (Melanoma-associated Antigen 12; MAGE-12 Antigen; MAGE-12F Antigen; Cancer/Testis Antigen 1.12; CT1.12; MAGE12) (AP); anti-MAGEA12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A10
Specificity
Recognizes human MAGEA12. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MAGEA12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa70-168 from human MAGEA12 (NP_005358) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in human liver.)

Western Blot (WB) (MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in human liver.)

Western Blot (WB)

(MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in Raw 264.7.)

Western Blot (WB) (MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in Raw 264.7.)

Western Blot (WB)

(MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in Jurkat.)

Western Blot (WB) (MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in Jurkat.)

Western Blot (WB)

(MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in NIH/3T3.)

Western Blot (WB) (MAGEA12 monoclonal antibody. Western Blot analysis of MAGEA12 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged MAGEA12 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAGEA12 is 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)
Related Product Information for anti-MAGEA12 antibody
MAGEA12 is a member of the melanoma antigen gene (MAGE) family. The proteins of this family are tumor-specific antigens that can be recognized by autologous cytolytic T lymphocytes. This gene is expressed in various tumors and tumor cell lines from different tissue origins, but not detected in normal tissues, except testis. The function of this gene is unknown. This and other MAGE genes form a gene cluster at chromosome Xq28 region.
Product Categories/Family for anti-MAGEA12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
melanoma-associated antigen 12
NCBI Official Synonym Full Names
MAGE family member A12
NCBI Official Symbol
MAGEA12
NCBI Official Synonym Symbols
CT1.12; MAGE12
NCBI Protein Information
melanoma-associated antigen 12
UniProt Protein Name
Melanoma-associated antigen 12
UniProt Gene Name
MAGEA12
UniProt Synonym Gene Names
MAGE12; CT1.12
UniProt Entry Name
MAGAC_HUMAN

NCBI Description

This gene is closely related to several other genes clustered on chromosome X. These genes may be overexpressed in tumors. Multiple alternatively spliced variants encoding the same protein have been identified. [provided by RefSeq, Jun 2014]

Uniprot Description

MAGEA12: Not known, though may play a role tumor transformation or progression. In vitro promotes cell viability in melanoma cell lines.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq28

Research Articles on MAGEA12

Similar Products

Product Notes

The MAGEA12 magea12 (Catalog #AAA6132178) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAGEA12 (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEA12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGEA12 magea12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGEA12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.