Western Blot (WB)
(WB Suggested Anti-MAGEA12 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Rabbit anti-Human MAGEA12 Polyclonal Antibody | anti-MAGEA12 antibody
MAGEA12 antibody - N-terminal region
Gene Names
MAGEA12; CT1.12; MAGE12
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAGEA12; Polyclonal Antibody; MAGEA12 antibody - N-terminal region; anti-MAGEA12 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVH
Sequence Length
314
Applicable Applications for anti-MAGEA12 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MAGEA12 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-MAGEA12 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-MAGEA12 antibody
This is a rabbit polyclonal antibody against MAGEA12. It was validated on Western Blot
Target Description: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Target Description: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-MAGEA12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
melanoma-associated antigen 12
NCBI Official Synonym Full Names
MAGE family member A12
NCBI Official Symbol
MAGEA12
NCBI Official Synonym Symbols
CT1.12; MAGE12
NCBI Protein Information
melanoma-associated antigen 12
UniProt Protein Name
Melanoma-associated antigen 12
Protein Family
UniProt Gene Name
MAGEA12
UniProt Synonym Gene Names
MAGE12; CT1.12
UniProt Entry Name
MAGAC_HUMAN
NCBI Description
This gene is closely related to several other genes clustered on chromosome X. These genes may be overexpressed in tumors. Multiple alternatively spliced variants encoding the same protein have been identified. [provided by RefSeq, Jun 2014]
Uniprot Description
MAGEA12: Not known, though may play a role tumor transformation or progression. In vitro promotes cell viability in melanoma cell lines.
Protein type: Cancer Testis Antigen (CTA)
Chromosomal Location of Human Ortholog: Xq28
Research Articles on MAGEA12
Similar Products
Product Notes
The MAGEA12 magea12 (Catalog #AAA3214552) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGEA12 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEA12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAGEA12 magea12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STLPTTINYT LWSQSDEGSS NEEQEGPSTF PDLETSFQVA LSRKMAELVH. It is sometimes possible for the material contained within the vial of "MAGEA12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
