Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CD81 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm and plasma membrane in hepatocytes and endothelial cells in sinusoidsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CD81 Polyclonal Antibody | anti-CD81 antibody

CD81 Antibody - C-terminal region

Gene Names
CD81; S5.7; CVID6; TAPA1; TSPAN28
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Cow, Dog, Goat, Horse, Pig, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CD81; Polyclonal Antibody; CD81 Antibody - C-terminal region; anti-CD81 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Cow, Dog, Goat, Horse, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5-1mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
Sequence Length
274
Applicable Applications for anti-CD81 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 83%; Dog: 93%; Goat: 83%; Horse: 75%; Human: 100%; Pig: 86%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human CD81
Blocking Peptide
For anti-CD81 (MBS3215934) antibody is (MBS3240836).
Protein size
274 amino acids
Replacement Item
This antibody may replace item sc-126607 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CD81 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm and plasma membrane in hepatocytes and endothelial cells in sinusoidsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CD81 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm and plasma membrane in hepatocytes and endothelial cells in sinusoidsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: CD81Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CD81Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CD81 antibody
This is a rabbit polyclonal antibody against CD81. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CD81 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
975
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
CD81 antigen isoform 2
NCBI Official Synonym Full Names
CD81 molecule
NCBI Official Symbol
CD81
NCBI Official Synonym Symbols
S5.7; CVID6; TAPA1; TSPAN28
NCBI Protein Information
CD81 antigen
UniProt Protein Name
CD81 antigen
Protein Family
UniProt Gene Name
CD81
UniProt Synonym Gene Names
TAPA1; TSPAN28; Tspan-28

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.(Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes. Associates with CLDN1 and the CLDN1-CD81 receptor complex is essential for HCV entry into host cell.

Research Articles on CD81

Similar Products

Product Notes

The CD81 cd81 (Catalog #AAA3215934) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD81 Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Cow, Dog, Goat, Horse, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CD81 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CD81 cd81 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKNNLCPSGS NIISNLFKED CHQKIDDLFS GKLYLIGIAA IVVAVIMIFE. It is sometimes possible for the material contained within the vial of "CD81, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.