Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human LNX1 Monoclonal Antibody | anti-LNX1 antibody

LNX1 (E3 Ubiquitin-protein Ligase LNX, Ligand of Numb-protein X 1, Numb-binding Protein 1, PDZ Domain-containing RING Finger Protein 2, LNX, PDZRN2, UNQ574/PRO1136) (FITC)

Gene Names
LNX1; LNX; MPDZ; PDZRN2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LNX1; Monoclonal Antibody; LNX1 (E3 Ubiquitin-protein Ligase LNX; Ligand of Numb-protein X 1; Numb-binding Protein 1; PDZ Domain-containing RING Finger Protein 2; LNX; PDZRN2; UNQ574/PRO1136) (FITC); anti-LNX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E3
Specificity
Recognizes human LNX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-LNX1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa19-119 from human LNX1 (NP_116011) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DNVGNLHFLYSELCKGAFHYGLTKDRKRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARPFERS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged LNX1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LNX1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-LNX1 antibody
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65.
Product Categories/Family for anti-LNX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase LNX isoform b
NCBI Official Synonym Full Names
ligand of numb-protein X 1
NCBI Official Symbol
LNX1
NCBI Official Synonym Symbols
LNX; MPDZ; PDZRN2
NCBI Protein Information
E3 ubiquitin-protein ligase LNX
UniProt Protein Name
E3 ubiquitin-protein ligase LNX
UniProt Gene Name
LNX1
UniProt Synonym Gene Names
LNX; PDZRN2
UniProt Entry Name
LNX1_HUMAN

NCBI Description

This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

LNX1: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ubiquitin ligase; Ligase; Adaptor/scaffold; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: cytoplasm

Molecular Function: ligase activity; PDZ domain binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding

Biological Process: protein homooligomerization; protein ubiquitination during ubiquitin-dependent protein catabolic process

Research Articles on LNX1

Similar Products

Product Notes

The LNX1 lnx1 (Catalog #AAA6148034) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LNX1 (E3 Ubiquitin-protein Ligase LNX, Ligand of Numb-protein X 1, Numb-binding Protein 1, PDZ Domain-containing RING Finger Protein 2, LNX, PDZRN2, UNQ574/PRO1136) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LNX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LNX1 lnx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LNX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.