Mouse FGR Monoclonal Antibody | anti-FGR antibody

FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog, FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr) (Biotin)

Cat. Num. AAA6170410

• Gene Names: FGR; SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: FGR; Monoclonal Antibody; FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog; FLJ43153; MGC75096; SRC2; c-fgr; c-src2; p55c-fgr; p58c-fgr) (Biotin); Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog; p58c-fgr; anti-FGR antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C12
• Specificity: Recognizes FGR.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 529

• Applicable Applications for anti-FGR antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FGR is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-FGR antibody

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Product Categories/Family for anti-FGR antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 39963676
• NCBI GeneID: 2268
• NCBI Official Full Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
• NCBI Official Synonym Full Names: FGR proto-oncogene, Src family tyrosine kinase
• NCBI Official Symbol: FGR
• NCBI Official Synonym Symbols: SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
• NCBI Protein Information: tyrosine-protein kinase Fgr
• Protein Family: Tyrosine-protein kinase

NCBI Description

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]