Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Mouse anti-Human LILRA2 Monoclonal Antibody | anti-LILRA2 antibody

LILRA2 (Leukocyte Immunoglobulin-like Receptor Subfamily A Member 2, CD85 Antigen-like Family Member H, ILT-1, Leukocyte Immunoglobulin-like Receptor 7, Immunoglobulin-like Transcript 1, LIR-7, ILT1, LIR7) (Biotin)

Gene Names
LILRA2; ILT1; LIR7; CD85H; LIR-7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LILRA2; Monoclonal Antibody; LILRA2 (Leukocyte Immunoglobulin-like Receptor Subfamily A Member 2; CD85 Antigen-like Family Member H; ILT-1; Leukocyte Immunoglobulin-like Receptor 7; Immunoglobulin-like Transcript 1; LIR-7; ILT1; LIR7) (Biotin); anti-LILRA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C7
Specificity
Recognizes human LILRA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
466
Applicable Applications for anti-LILRA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa322-384 from human LILRA2 (NP_006857) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)
Related Product Information for anti-LILRA2 antibody
Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor.
Product Categories/Family for anti-LILRA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily A member 2 isoform b
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor A2
NCBI Official Symbol
LILRA2
NCBI Official Synonym Symbols
ILT1; LIR7; CD85H; LIR-7
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily A member 2
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily A member 2
UniProt Gene Name
LILRA2
UniProt Synonym Gene Names
ILT1; LIR7; ILT-1; LIR-7
UniProt Entry Name
LIRA2_HUMAN

NCBI Description

This gene encodes a member of a family of immunoreceptors that are expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses innate immune response. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and there is a pseudogene for this gene on chromosome 3. [provided by RefSeq, Mar 2014]

Uniprot Description

LILRA2: Does not bind class I MHC antigens. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to membrane; extracellular region

Molecular Function: receptor activity; antigen binding

Biological Process: immune system process; defense response; signal transduction

Research Articles on LILRA2

Similar Products

Product Notes

The LILRA2 lilra2 (Catalog #AAA6142708) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LILRA2 (Leukocyte Immunoglobulin-like Receptor Subfamily A Member 2, CD85 Antigen-like Family Member H, ILT-1, Leukocyte Immunoglobulin-like Receptor 7, Immunoglobulin-like Transcript 1, LIR-7, ILT1, LIR7) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LILRA2 lilra2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LILRA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.