Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (44kD).)

Mouse anti-Human LDOC1 Monoclonal Antibody | anti-LDOC1 antibody

LDOC1 (Protein LDOC1, Leucine Zipper Protein Down-regulated in Cancer Cells, BCUR1)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LDOC1; Monoclonal Antibody; LDOC1 (Protein LDOC1; Leucine Zipper Protein Down-regulated in Cancer Cells; BCUR1); Anti -LDOC1 (Protein LDOC1; anti-LDOC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E5
Specificity
Recognizes human LDOC1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Applicable Applications for anti-LDOC1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full-length recombinant corresponding to aa1-146 from LDOC1 (NP_036449) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44kD).)

Western Blot (WB) (Western Blot detection against Immunogen (44kD).)

Western Blot (WB)

(Western Blot analysis of LDOC1 expression in transfected 293T cell line by LDOC1 monoclonal antibody.|Lane 1: LDOC1 transfected lysate (17kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LDOC1 expression in transfected 293T cell line by LDOC1 monoclonal antibody.|Lane 1: LDOC1 transfected lysate (17kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged LDOC1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LDOC1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-LDOC1 antibody
Leucine Zipper, Down-regulated in Cancer 1 (LDOC1) contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers.
Product Categories/Family for anti-LDOC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
16,968 Da
NCBI Official Full Name
LDOC1
UniProt Protein Name
Protein LDOC1
Protein Family
UniProt Gene Name
LDOC1
UniProt Synonym Gene Names
BCUR1
UniProt Entry Name
LDOC1_HUMAN

Uniprot Description

LDOC1: May have an important role in the development and/or progression of some cancers. Belongs to the LDOC1 family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: Xq27

Cellular Component: nucleolus; nucleus

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation

Similar Products

Product Notes

The LDOC1 ldoc1 (Catalog #AAA643617) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LDOC1 (Protein LDOC1, Leucine Zipper Protein Down-regulated in Cancer Cells, BCUR1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LDOC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the LDOC1 ldoc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVDELVLLLH ALLMRHRALS IENSQLMEQL RLLVCERASL LRQVRPPSCP VPFPETFNGE SSRLPEFIVQ TASYMLVNEN RFCNDAMKVA FLISLLTGEA EEWVVPYIEM DSPILGDYRA FLDEMKQCFG WDDDEDDDDE EEEDDY. It is sometimes possible for the material contained within the vial of "LDOC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.