Mouse anti-Human LDOC1 Monoclonal Antibody | anti-LDOC1 antibody

LDOC1 (Protein LDOC1, Leucine Zipper Protein Down-regulated in Cancer Cells, BCUR1) (PE)

Cat. Num. AAA6158596

• Gene Names: LDOC1; Mar7; RTL7; BCUR1; Mart7; SIRH7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LDOC1; Monoclonal Antibody; LDOC1 (Protein LDOC1; Leucine Zipper Protein Down-regulated in Cancer Cells; BCUR1) (PE); anti-LDOC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E5
• Specificity: Recognizes human LDOC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-LDOC1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-146 from LDOC1 (NP_036449) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44kD).)

Western Blot (WB)

(Western Blot analysis of LDOC1 expression in transfected 293T cell line by LDOC1 monoclonal antibody. Lane 1: LDOC1 transfected lysate (17kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged LDOC1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-LDOC1 antibody

Leucine Zipper, Down-regulated in Cancer 1 (LDOC1) contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers.

Product Categories/Family for anti-LDOC1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 6912480
• NCBI GeneID: 23641
• NCBI Accession #: NP_036449
• NCBI GenBank Nucleotide #: NM_012317
• UniProt Accession #: O95751
• Molecular Weight: 17kDa
• NCBI Official Full Name: protein LDOC1
• NCBI Official Synonym Full Names: LDOC1 regulator of NFKB signaling
• NCBI Official Symbol: LDOC1
• NCBI Official Synonym Symbols: Mar7; RTL7; BCUR1; Mart7; SIRH7
• NCBI Protein Information: protein LDOC1
• UniProt Protein Name: Protein LDOC1
• Protein Family: Protein
• UniProt Gene Name: LDOC1
• UniProt Synonym Gene Names: BCUR1
• UniProt Entry Name: LDOC1_HUMAN

NCBI Description

The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq, Jul 2008]

Uniprot Description

LDOC1: May have an important role in the development and/or progression of some cancers. Belongs to the LDOC1 family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: Xq27

Cellular Component: nucleolus; nucleus

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation