Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (51.74kD))

Mouse anti-Human LAT Monoclonal Antibody | anti-LAT antibody

LAT (Linker for Activation of T-cells Family Member 1, 36kD Phospho-tyrosine Adapter Protein, pp36, p36-38) (PE)

Gene Names
LAT; LAT1; pp36
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LAT; Monoclonal Antibody; LAT (Linker for Activation of T-cells Family Member 1; 36kD Phospho-tyrosine Adapter Protein; pp36; p36-38) (PE); anti-LAT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B11-1D5
Specificity
Recognizes human LAT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LAT antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-234 from human LAT (AAH11563) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.74kD))

Western Blot (WB) (Western Blot detection against Immunogen (51.74kD))

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LAT on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LAT on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LAT is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LAT is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-LAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
27,774 Da
NCBI Official Full Name
Homo sapiens linker for activation of T cells, mRNA
NCBI Official Synonym Full Names
linker for activation of T-cells
NCBI Official Symbol
LAT
NCBI Official Synonym Symbols
LAT1; pp36
NCBI Protein Information
linker for activation of T-cells family member 1
Protein Family

NCBI Description

The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Research Articles on LAT

Similar Products

Product Notes

The LAT (Catalog #AAA6158581) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LAT (Linker for Activation of T-cells Family Member 1, 36kD Phospho-tyrosine Adapter Protein, pp36, p36-38) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LAT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LAT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.