Mouse anti-Human LAT Monoclonal Antibody | anti-LAT antibody

LAT (Linker for Activation of T-cells Family Member 1, 36kD Phospho-tyrosine Adapter Protein, pp36, p36-38) (HRP)

Cat. Num. AAA6153278

• Gene Names: LAT; LAT1; pp36
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LAT; Monoclonal Antibody; LAT (Linker for Activation of T-cells Family Member 1; 36kD Phospho-tyrosine Adapter Protein; pp36; p36-38) (HRP); anti-LAT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B11-1D5
• Specificity: Recognizes human LAT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-LAT antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-234 from human LAT (AAH11563) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.74kD))

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LAT on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LAT is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-LAT antibody

Antibodies; T Cells

NCBI and Uniprot Product Information

• NCBI GI #: 15079450
• NCBI GeneID: 27040
• Molecular Weight: 27,774 Da
• NCBI Official Full Name: Homo sapiens linker for activation of T cells, mRNA
• NCBI Official Synonym Full Names: linker for activation of T-cells
• NCBI Official Symbol: LAT
• NCBI Official Synonym Symbols: LAT1; pp36
• NCBI Protein Information: linker for activation of T-cells family member 1
• Protein Family: Latexin

NCBI Description

The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]