Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IREB2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit IREB2 Polyclonal Antibody | anti-IREB2 antibody

IREB2 antibody - middle region

Gene Names
IREB2; ACO3; IRP2; IRP2AD; IRE-BP2; IRE-BP 2
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IREB2; Polyclonal Antibody; IREB2 antibody - middle region; anti-IREB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK
Sequence Length
963
Applicable Applications for anti-IREB2 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IREB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IREB2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IREB2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Researcher: Dr. Hao Zhu, University of Kansas Medical CenterApplication: Western blottingSpecies+tissue/cell type: Mouse liver extractHow many ug'sof tissue/cell lysate run on the gel:1. 60 ug mouse liver extract2. 60 ug mouse liver extract3. 60 ug mouse liver extractPrimary antibody dilution: 1:500Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:3000)

Western Blot (WB) (Researcher: Dr. Hao Zhu, University of Kansas Medical CenterApplication: Western blottingSpecies+tissue/cell type: Mouse liver extractHow many ug'sof tissue/cell lysate run on the gel:1. 60 ug mouse liver extract2. 60 ug mouse liver extract3. 60 ug mouse liver extractPrimary antibody dilution: 1:500Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:3000)

Western Blot (WB)

(WB Suggested Anti-IREB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-IREB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-IREB2 antibody
This is a rabbit polyclonal antibody against IREB2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
105kDa
NCBI Official Full Name
iron-responsive element-binding protein 2 isoform 1
NCBI Official Synonym Full Names
iron responsive element binding protein 2
NCBI Official Symbol
IREB2
NCBI Official Synonym Symbols
ACO3; IRP2; IRP2AD; IRE-BP2; IRE-BP 2
NCBI Protein Information
iron-responsive element-binding protein 2
UniProt Protein Name
Iron-responsive element-binding protein 2
UniProt Gene Name
IREB2
UniProt Synonym Gene Names
IRE-BP 2; IRP2
UniProt Entry Name
IREB2_HUMAN

NCBI Description

The protein encoded by this gene is an RNA-binding protein that acts to regulate iron levels in the cells by regulating the translation and stability of mRNAs that affect iron homeostasis under conditions when iron is depleted. When iron levels are low, this protein binds to iron-responsive elements (IRES), stem-loop structures located either in the 5' or 3' UTRs. Binding to the 5' UTR represses translation, while binding to the 3' UTR inhibits mRNA degradation. When iron is found in the cell, this protein is degraded in a F-box and leucine rich repeat protein 5-dependent manner. Variants in this gene have been associated with lung cancer and chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2017]

Uniprot Description

IREB2: RNA-binding protein that binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'- UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. Binding to the IRE element in ferritin results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA. Belongs to the aconitase/IPM isomerase family.

Protein type: RNA-binding; Translation

Chromosomal Location of Human Ortholog: 15q25.1

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: protein binding; iron-responsive element binding; translation repressor activity; RNA binding; metal ion binding; 4 iron, 4 sulfur cluster binding

Biological Process: erythrocyte homeostasis; response to retinoic acid; cellular iron ion homeostasis; negative regulation of translation; response to iron(II) ion; osteoclast differentiation; iron ion transport; protoporphyrinogen IX biosynthetic process; intestinal absorption; aging; post-embryonic development

Research Articles on IREB2

Similar Products

Product Notes

The IREB2 ireb2 (Catalog #AAA3205284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IREB2 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's IREB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IREB2 ireb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQINLNSIVP SVSGPKRPQD RVAVTDMKSD FQACLNEKVG FKGFQIAAEK. It is sometimes possible for the material contained within the vial of "IREB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.