Mouse anti-Human LASS4 Monoclonal Antibody | anti-LASS4 antibody

LASS4 (LAG1 Longevity Assurance Homolog 4, LAG1 Homolog Ceramide Synthase 4, CERS4, FLJ12089, Trh1, FLJ12089) (PE)

Cat. Num. AAA6158579

• Gene Names: CERS4; Trh1; LASS4
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LASS4; Monoclonal Antibody; LASS4 (LAG1 Longevity Assurance Homolog 4; LAG1 Homolog Ceramide Synthase 4; CERS4; FLJ12089; Trh1; FLJ12089) (PE); anti-LASS4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 7D5
• Specificity: Recognizes human LASS4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-LASS4 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa57-140 from human LASS4 (NP_078828) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.24kD).)

Western Blot (WB)

(LASS4 monoclonal antibody, Western Blot analysis of LASS4 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody. Lane 1: LASS4 transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LASS4 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged LASS4 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-LASS4 antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 205360977
• NCBI GeneID: 79603
• NCBI Accession #: NP_078828
• NCBI GenBank Nucleotide #: NM_024552
• UniProt Accession #: Q9HA82
• Molecular Weight: 46kDa
• NCBI Official Full Name: ceramide synthase 4
• NCBI Official Synonym Full Names: ceramide synthase 4
• NCBI Official Symbol: CERS4
• NCBI Official Synonym Symbols: Trh1; LASS4
• NCBI Protein Information: ceramide synthase 4
• UniProt Protein Name: Ceramide synthase 4
• UniProt Gene Name: CERS4
• UniProt Synonym Gene Names: LASS4; CerS4
• UniProt Entry Name: CERS4_HUMAN

Uniprot Description

Lass4: May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner.

Protein type: Membrane protein, multi-pass; DNA-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; integral to membrane

Molecular Function: DNA binding; sphingosine N-acyltransferase activity

Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; ceramide biosynthetic process