Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.24kD).)

Mouse anti-Human LASS4 Monoclonal Antibody | anti-LASS4 antibody

LASS4 (LAG1 Longevity Assurance Homolog 4, LAG1 Homolog Ceramide Synthase 4, CERS4, FLJ12089, Trh1, FLJ12089) (AP)

Gene Names
CERS4; Trh1; LASS4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LASS4; Monoclonal Antibody; LASS4 (LAG1 Longevity Assurance Homolog 4; LAG1 Homolog Ceramide Synthase 4; CERS4; FLJ12089; Trh1; FLJ12089) (AP); anti-LASS4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7D5
Specificity
Recognizes human LASS4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-LASS4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa57-140 from human LASS4 (NP_078828) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.24kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.24kD).)

Western Blot (WB)

(LASS4 monoclonal antibody, Western Blot analysis of LASS4 expression in HeLa.)

Western Blot (WB) (LASS4 monoclonal antibody, Western Blot analysis of LASS4 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody. Lane 1: LASS4 transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody. Lane 1: LASS4 transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LASS4 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LASS4 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged LASS4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LASS4 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-LASS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
ceramide synthase 4
NCBI Official Synonym Full Names
ceramide synthase 4
NCBI Official Symbol
CERS4
NCBI Official Synonym Symbols
Trh1; LASS4
NCBI Protein Information
ceramide synthase 4
UniProt Protein Name
Ceramide synthase 4
UniProt Gene Name
CERS4
UniProt Synonym Gene Names
LASS4; CerS4
UniProt Entry Name
CERS4_HUMAN

Uniprot Description

Lass4: May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner.

Protein type: Membrane protein, multi-pass; DNA-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; integral to membrane

Molecular Function: DNA binding; sphingosine N-acyltransferase activity

Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; ceramide biosynthetic process

Research Articles on LASS4

Similar Products

Product Notes

The LASS4 cers4 (Catalog #AAA6132064) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LASS4 (LAG1 Longevity Assurance Homolog 4, LAG1 Homolog Ceramide Synthase 4, CERS4, FLJ12089, Trh1, FLJ12089) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LASS4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LASS4 cers4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LASS4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.