Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.68kD).)

Mouse anti-Human ATP13A2 Monoclonal Antibody | anti-ATP13A2 antibody

ATP13A2 (PARK9, Probable Cation-transporting ATPase 13A2) (AP)

Gene Names
ATP13A2; CLN12; KRPPD; PARK9; SPG78; HSA9947
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP13A2; Monoclonal Antibody; ATP13A2 (PARK9; Probable Cation-transporting ATPase 13A2) (AP); anti-ATP13A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B7
Specificity
Recognizes human ATP13A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1180
Applicable Applications for anti-ATP13A2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa68-155 from ATP13A2 (NP_071372) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEA*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.68kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.68kD).)

Testing Data

(Detection limit for recombinant GST tagged ATP13A2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATP13A2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-ATP13A2 antibody
This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ATP13A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cation-transporting ATPase 13A2 isoform 1
NCBI Official Synonym Full Names
ATPase cation transporting 13A2
NCBI Official Symbol
ATP13A2
NCBI Official Synonym Symbols
CLN12; KRPPD; PARK9; SPG78; HSA9947
NCBI Protein Information
cation-transporting ATPase 13A2
UniProt Protein Name
Cation-transporting ATPase 13A2
UniProt Gene Name
ATP13A2

NCBI Description

This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2008]

Uniprot Description

ATP13A2: May play a role in intracellular cation homeostasis and the maintenance of neuronal integrity. Expressed in brain; protein levels are markedly increased in brain from subjects with Parkinson disease and subjects with dementia with Lewy bodies. Detected in pyramidal neurons located throughout the cingulate cortex. In the substantia nigra, it is found in neuromelanin- positive dopaminergic neurons. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type V subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.3.-; Hydrolase; Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, ion channel

Chromosomal Location of Human Ortholog: 1p36.13

Cellular Component: autophagic vacuole; cell soma; integral component of membrane; integral component of plasma membrane; late endosome; lysosomal lumen; lysosomal membrane; lysosome; multivesicular body; neuron projection; transport vesicle; vesicle; vesicle membrane

Molecular Function: ATP binding; ATPase activity; calcium-transporting ATPase activity; cation-transporting ATPase activity; manganese ion binding; protein binding; zinc ion binding

Biological Process: cellular calcium ion homeostasis; cellular cation homeostasis; cellular iron ion homeostasis; cellular zinc ion homeostasis; positive regulation of protein secretion; protein autophosphorylation; regulation of autophagic vacuole size; regulation of endopeptidase activity; regulation of intracellular protein transport; regulation of macroautophagy; zinc ion homeostasis

Disease: Kufor-rakeb Syndrome; Spastic Paraplegia 78, Autosomal Recessive

Research Articles on ATP13A2

Similar Products

Product Notes

The ATP13A2 atp13a2 (Catalog #AAA6130122) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP13A2 (PARK9, Probable Cation-transporting ATPase 13A2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP13A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP13A2 atp13a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP13A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.