Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human KLRC3 Monoclonal Antibody | anti-KLRC3 antibody

KLRC3 (NKG2-E Type II Integral Membrane Protein, NK Cell Receptor E, NKG2-E-activating NK Receptor, NKG2E) (FITC)

Gene Names
KLRC3; NKG2E; NKG2-E
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLRC3; Monoclonal Antibody; KLRC3 (NKG2-E Type II Integral Membrane Protein; NK Cell Receptor E; NKG2-E-activating NK Receptor; NKG2E) (FITC); anti-KLRC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D5
Specificity
Recognizes human KLRC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-KLRC3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa132-240 from human KLRC3 (NP_002252) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Testing Data

(Detection limit for recombinant GST tagged KLRC3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KLRC3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-KLRC3 antibody
Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Product Categories/Family for anti-KLRC3 antibody
References
1. Glycosylation-related gene expression is linked to differentiation status in glioblastomas undifferentiated cells. Cheray M, Petit D, Forestier L, Karayan-Tapon L, Maftah A, Jauberteau MO, Battu S, Gallet FP, Lalloue F.Cancer Letters (2011), doi: 10.1016/ j.canlet.2011.07.027

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa (171aa)
NCBI Official Full Name
NKG2-E type II integral membrane protein isoform E
NCBI Official Synonym Full Names
killer cell lectin like receptor C3
NCBI Official Symbol
KLRC3
NCBI Official Synonym Symbols
NKG2E; NKG2-E
NCBI Protein Information
NKG2-E type II integral membrane protein
UniProt Protein Name
NKG2-E type II integral membrane protein
UniProt Gene Name
KLRC3
UniProt Synonym Gene Names
NKG2E
UniProt Entry Name
NKG2E_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

KLRC3: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to membrane

Molecular Function: transmembrane receptor activity; carbohydrate binding

Biological Process: cellular defense response; signal transduction

Research Articles on KLRC3

Similar Products

Product Notes

The KLRC3 klrc3 (Catalog #AAA6147935) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLRC3 (NKG2-E Type II Integral Membrane Protein, NK Cell Receptor E, NKG2-E-activating NK Receptor, NKG2E) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLRC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLRC3 klrc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLRC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.