Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human CIDEB Monoclonal Antibody | anti-CIDEB antibody

CIDEB (Cell Death Activator CIDE-B, Cell Death-inducing DFFA-like Effector B) (FITC)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CIDEB; Monoclonal Antibody; CIDEB (Cell Death Activator CIDE-B; Cell Death-inducing DFFA-like Effector B) (FITC); anti-CIDEB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A10
Specificity
Recognizes human CIDEB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CIDEB antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-111 from human CIDEB (NP_055245) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSP*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(CIDEB monoclonal antibody Western Blot analysis of CIDEB expression in HepG2.)

Western Blot (WB) (CIDEB monoclonal antibody Western Blot analysis of CIDEB expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of CIDEB expression in transfected 293T cell line by CIDEB monoclonal antibody. Lane 1: CIDEB transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CIDEB expression in transfected 293T cell line by CIDEB monoclonal antibody. Lane 1: CIDEB transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CIDEB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CIDEB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CIDEB is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CIDEB is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-CIDEB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
cell death activator CIDE-B
NCBI Official Synonym Full Names
cell death inducing DFFA like effector b
NCBI Official Symbol
CIDEB
NCBI Protein Information
cell death activator CIDE-B
UniProt Protein Name
Cell death activator CIDE-B
Protein Family
UniProt Gene Name
CIDEB
UniProt Entry Name
CIDEB_HUMAN

Uniprot Description

CIDEB: Activates apoptosis.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 14q12

Cellular Component: perinuclear region of cytoplasm; lipid particle; cytosol

Molecular Function: identical protein binding; protein binding

Biological Process: regulation of apoptosis; DNA damage response, signal transduction resulting in induction of apoptosis; apoptosis

Research Articles on CIDEB

Similar Products

Product Notes

The CIDEB cideb (Catalog #AAA6146513) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CIDEB (Cell Death Activator CIDE-B, Cell Death-inducing DFFA-like Effector B) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CIDEB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CIDEB cideb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CIDEB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.