Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD) using MBS646056.)

Mouse anti-Human KLK8 Monoclonal Antibody | anti-KLK8 antibody

KLK8 (Kallikrein-8, hK8, Neuropsin, NP, Ovasin, Serine Protease 19, Serine Protease TADG-14, Tumor-associated Differentially Expressed Gene 14 Protein, NRPN, PRSS19, TADG14, UNQ283/PRO322)

Gene Names
KLK8; NP; HNP; NRPN; PRSS19; TADG14
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KLK8; Monoclonal Antibody; KLK8 (Kallikrein-8; hK8; Neuropsin; NP; Ovasin; Serine Protease 19; Serine Protease TADG-14; Tumor-associated Differentially Expressed Gene 14 Protein; NRPN; PRSS19; TADG14; UNQ283/PRO322); Anti -KLK8 (Kallikrein-8; anti-KLK8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F11
Specificity
Recognizes human KLK8.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKG*
Applicable Applications for anti-KLK8 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa97-205 from KLK8 (NP_009127) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD) using MBS646056.)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD) using MBS646056.)

Western Blot (WB)

(Western Blot analysis of KLK8 expression in A-431 using MBS646056.)

Western Blot (WB) (Western Blot analysis of KLK8 expression in A-431 using MBS646056.)

Immunofluorescence (IF)

(Immunofluorescence of MBS646056 on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of MBS646056 on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KLK8 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KLK8 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-KLK8 antibody
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.
Product Categories/Family for anti-KLK8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,048 Da
NCBI Official Full Name
kallikrein-8 isoform 4
NCBI Official Synonym Full Names
kallikrein-related peptidase 8
NCBI Official Symbol
KLK8
NCBI Official Synonym Symbols
NP; HNP; NRPN; PRSS19; TADG14
NCBI Protein Information
kallikrein-8; ovasin; serine protease 19; serine protease TADG-14; tumor-associated differentially expressed gene 14 protein
UniProt Protein Name
Kallikrein-8
Protein Family
UniProt Gene Name
KLK8
UniProt Synonym Gene Names
NRPN; PRSS19; TADG14; hK8; NP
UniProt Entry Name
KLK8_HUMAN

NCBI Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

Function: Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. Ref.16

Catalytic activity: Cleavage of amide substrates following the basic amino acids Arg or Lys at the P1 position, with a preference for Arg over Lys. Ref.16

Enzyme regulation: Inhibited by a range of serine protease inhibitors including antipain, aprotinin, leupeptin, benzamidine and soybean trypsin inhibitor. Ref.16

Subunit structure: Interacts with SPINK9. Ref.19

Subcellular location: Secreted. Cytoplasm. Note: Shows a cytoplasmic distribution in the keratinocytes. Ref.18

Tissue specificity: Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes. Ref.5 Ref.13 Ref.14 Ref.18

Miscellaneous: Expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer.

Sequence similarities: Belongs to the peptidase S1 family. Kallikrein subfamily.Contains 1 peptidase S1 domain.

Biophysicochemical propertiesKinetic parameters:KM=0.07 mM for Pro-Phe-Arg-MCA Ref.16KM=0.07 mM for Z-Val-Val-Arg-MCAKM=0.07 mM for Boc-Val-Pro-Arg-MCAKM=0.10 mM for Boc-Leu-Lys-Arg-MCAKM=0.10 mM for Boc-Val-Leu-Lys-MCAKM=0.07 mM for Boc-Phe-Ser-Arg-MCAVmax=7.1 µmol/min/mg enzyme toward Pro-Phe-Arg-MCAVmax=5.4 µmol/min/mg enzyme toward Z-Val-Val-Arg-MCAVmax=3.9 µmol/min/mg enzyme toward Boc-Val-Pro-Arg-MCAVmax=2.6 µmol/min/mg enzyme toward Boc-Leu-Lys-Arg-MCAVmax=1.9 µmol/min/mg enzyme toward Boc-Val-Leu-Lys-MCAVmax=1.6 µmol/min/mg enzyme toward Boc-Phe-Ser-Arg-MCApH dependence:Optimum pH is 8.5. Active from pH 7-10.

Research Articles on KLK8

Similar Products

Product Notes

The KLK8 klk8 (Catalog #AAA646056) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLK8 (Kallikrein-8, hK8, Neuropsin, NP, Ovasin, Serine Protease 19, Serine Protease TADG-14, Tumor-associated Differentially Expressed Gene 14 Protein, NRPN, PRSS19, TADG14, UNQ283/PRO322) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLK8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the KLK8 klk8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EIPVVQSIPH PCYNSSDVED HNHDLMLLQL RDQASLGSKV KPISLADHCT QPGQKCTVSG WGTVTSPREN FPDTLNCAEV KIFPQKKCED AYPGQITDGM VCAGSSKG*. It is sometimes possible for the material contained within the vial of "KLK8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.