Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KIT expression in transfected 293T cell line by KIT monoclonal antibody (M10), clone x1.Lane 1: KIT transfected lysate(109.865 KDa).Lane 2: Non-transfected lysate.)

Mouse KIT Monoclonal Antibody | anti-KIT antibody

KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog, C-Kit, CD117, PBT, SCFR) (AP)

Gene Names
KIT; PBT; SCFR; C-Kit; CD117
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
KIT; Monoclonal Antibody; KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog; C-Kit; CD117; PBT; SCFR) (AP); v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog; SCFR; anti-KIT antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
X1
Specificity
Recognizes KIT.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-KIT antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KIT (NP_000213, 41aa-140aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KIT expression in transfected 293T cell line by KIT monoclonal antibody (M10), clone x1.Lane 1: KIT transfected lysate(109.865 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KIT expression in transfected 293T cell line by KIT monoclonal antibody (M10), clone x1.Lane 1: KIT transfected lysate(109.865 KDa).Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to KIT on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to KIT on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to KIT on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to KIT on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KIT is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KIT is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-KIT antibody
This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-KIT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57.1kDa (507aa) 50-70kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
mast/stem cell growth factor receptor Kit isoform 1
NCBI Official Synonym Full Names
KIT proto-oncogene receptor tyrosine kinase
NCBI Official Symbol
KIT
NCBI Official Synonym Symbols
PBT; SCFR; C-Kit; CD117
NCBI Protein Information
mast/stem cell growth factor receptor Kit
UniProt Protein Name
Mast/stem cell growth factor receptor Kit
Protein Family
UniProt Gene Name
KIT
UniProt Synonym Gene Names
SCFR; SCFR; PBT
UniProt Entry Name
KIT_HUMAN

NCBI Description

This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Kit: a receptor tyrosine kinase and a member of the subfamily that includes PDGF, CSF-1 and FLT-3/flk-2 receptors. Receptor for stem cell factor. Plays a critical role in hematopoietic stem cell, mast cell, melanocyte and germ cell development. Ligand binding induces autophosphorylation, dimerization and activation, leading to the recruitment and phosphorylation of downstream SH2-containing signaling components including PLC-gamma, PI3 kinase p85, SHP2 and CrkL, linking c-Kit to various cell signaling pathways. Molecular lesions that impair the kinase activity of c-Kit are associated with a variety of developmental disorders, while mutations that constitutively activate c-Kit can lead to hyperplasia and tumorigenesis. Activating mutations cause >90% of gastrointestinal stromal tumors (GIST); successfully treated with inhibitors Gleevec (imatinib, Glivec) and Sutent (Sutinib, SU11248). Activating mutations also induce mastocytosis. Autocrine/paracrine stimulation may drive some lung and other tumors. Loss of expression associated with melanoma progression. Familial loss of function mutations cause piebaldism, with defects in hair and skin pigmentation due to lack of melanocytes.

Protein type: Membrane protein, integral; Kinase, protein; Protein kinase, TK; Oncoprotein; EC 2.7.10.1; Protein kinase, tyrosine (receptor); TK group; PDGFR family

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: extracellular space; internal side of plasma membrane; mast cell granule; acrosome; plasma membrane; integral to membrane; intercellular junction; external side of plasma membrane

Molecular Function: protein binding; protein homodimerization activity; protease binding; metal ion binding; protein-tyrosine kinase activity; cytokine binding; stem cell factor receptor activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: nerve growth factor receptor signaling pathway; activation of MAPK activity; somatic stem cell maintenance; germ cell programmed cell death; positive regulation of JAK-STAT cascade; lymphoid progenitor cell differentiation; positive regulation of long-term neuronal synaptic plasticity; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of cell shape; epithelial cell proliferation; germ cell migration; erythrocyte differentiation; somatic stem cell division; T cell differentiation; fibroblast growth factor receptor signaling pathway; embryonic hemopoiesis; mast cell chemotaxis; stem cell differentiation; detection of mechanical stimulus involved in sensory perception of sound; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of tyrosine phosphorylation of Stat1 protein; immature B cell differentiation; positive regulation of transcription factor activity; regulation of pigmentation during development; glycosphingolipid metabolic process; mast cell cytokine production; peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; signal transduction; myeloid progenitor cell differentiation; ovarian follicle development; positive regulation of MAPKKK cascade; positive regulation of cell proliferation; melanocyte differentiation; negative regulation of programmed cell death; visual learning; hemopoiesis; inflammatory response; positive regulation of Notch signaling pathway; epidermal growth factor receptor signaling pathway; lamellipodium biogenesis; phosphoinositide-mediated signaling; dendritic cell cytokine production; cytokine and chemokine mediated signaling pathway; male gonad development; stem cell maintenance; positive regulation of phosphoinositide 3-kinase activity; mast cell degranulation; regulation of cell proliferation; positive regulation of pseudopodium formation; gut development; positive regulation of tyrosine phosphorylation of Stat5 protein; pigmentation; actin cytoskeleton reorganization; innate immune response; spermatogenesis; spermatid development; positive regulation of cell migration

Disease: Gastrointestinal Stromal Tumor; Mast Cell Disease; Piebald Trait; Testicular Germ Cell Tumor

Research Articles on KIT

Similar Products

Product Notes

The KIT kit (Catalog #AAA6165320) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KIT can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIT kit for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.