Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Mouse anti-Human KIF16B Monoclonal Antibody | anti-KIF16B antibody
KIF16B (C20orf23, Kinesin-like Protein KIF16B, Sorting Nexin-23, KIAA1590, SNX23) (PE)
Gene Names
KIF16B; SNX23; C20orf23; KISC20ORF
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KIF16B; Monoclonal Antibody; KIF16B (C20orf23; Kinesin-like Protein KIF16B; Sorting Nexin-23; KIAA1590; SNX23) (PE); anti-KIF16B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human KIF16B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-KIF16B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa65-175 from human KIF16B (AAH34984) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DDLKDPIKISIPRYVLCGQGKDAHFEFEVKLAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Testing Data
(Detection limit for recombinant GST tagged KIF16B is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged KIF16B is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-KIF16B antibody
Plus end-directed microtubule-dependent motor protein involved in endosome transport and receptor recycling and degradation. Regulates the plus end motility of early endosomes and the balance between recycling and degradation of receptors such as EGF receptor (EGFR) and FGF receptor (FGFR). Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development.
Product Categories/Family for anti-KIF16B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
147,398 Da
NCBI Official Full Name
Homo sapiens kinesin family member 16B, mRNA
NCBI Official Synonym Full Names
kinesin family member 16B
NCBI Official Symbol
KIF16B
NCBI Official Synonym Symbols
SNX23; C20orf23; KISC20ORF
NCBI Protein Information
kinesin-like protein KIF16B
Protein Family
NCBI Description
The protein encoded by this gene is a kinesin-like protein that may be involved in intracellular trafficking. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
Research Articles on KIF16B
Similar Products
Product Notes
The KIF16B (Catalog #AAA6158507) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KIF16B (C20orf23, Kinesin-like Protein KIF16B, Sorting Nexin-23, KIAA1590, SNX23) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIF16B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIF16B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIF16B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
