Mouse KDR Monoclonal Antibody | anti-KDR antibody

KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase), CD309, FLK1, VEGFR, VEGFR2) (Biotin)

Cat. Num. AAA6170452

• Gene Names: KDR; FLK1; CD309; VEGFR; VEGFR2
• Applications: Western Blot
• Purity: Purified
• Synonyms: KDR; Monoclonal Antibody; KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase); CD309; FLK1; VEGFR; VEGFR2) (Biotin); Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase); VEGFR2; anti-KDR antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F1
• Specificity: Recognizes KDR.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-KDR antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: KDR (NP_002244, 31aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged KDR is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-KDR antibody

Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas. [provided by RefSeq]

Product Categories/Family for anti-KDR antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 11321597
• NCBI GeneID: 3791
• NCBI Accession #: NP_002244
• NCBI GenBank Nucleotide #: NM_002253.3
• UniProt Accession #: P35968; O60723; Q14178; A2RRS0; B5A925; C5IFA0
• Molecular Weight: 110.5kDa (987aa) 100-150KDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: vascular endothelial growth factor receptor 2
• NCBI Official Synonym Full Names: kinase insert domain receptor
• NCBI Official Symbol: KDR
• NCBI Official Synonym Symbols: FLK1; CD309; VEGFR; VEGFR2
• NCBI Protein Information: vascular endothelial growth factor receptor 2
• UniProt Protein Name: Vascular endothelial growth factor receptor 2
• Protein Family: Vascular endothelial growth factor receptor
• UniProt Gene Name: KDR
• UniProt Synonym Gene Names: FLK1; VEGFR2; VEGFR-2; FLK-1; KDR
• UniProt Entry Name: VGFR2_HUMAN

NCBI Description

Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas. [provided by RefSeq, May 2009]

Uniprot Description

VEGFR2: a receptor tyrosine kinase of the VEGFR family. High affinity receptor for VEGF and VEGF-C. Ligand binding induces autophosphorylation and activation. Activated receptor recruits proteins including Shc, GRB2, PI3K, Nck, SHP-1 and SHP-2. Plays a key role in vascular development and regulation of vascular permeability.

Protein type: Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); Protein kinase, TK; EC 2.7.10.1; TK group; VEGFR family

Chromosomal Location of Human Ortholog: 4q11-q12

Cellular Component: Golgi apparatus; integral to plasma membrane; endoplasmic reticulum; early endosome; cytoplasmic membrane-bound vesicle; extracellular region; plasma membrane; cell junction; nucleus; endosome; external side of plasma membrane; lipid raft

Molecular Function: integrin binding; vascular endothelial growth factor receptor activity; protein binding; growth factor binding; protein-tyrosine kinase activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; Hsp90 protein binding; ATP binding

Biological Process: extracellular matrix organization and biogenesis; positive regulation of positive chemotaxis; peptidyl-tyrosine phosphorylation; viral reproduction; protein amino acid autophosphorylation; cell maturation; calcium ion homeostasis; regulation of cell shape; positive regulation of focal adhesion formation; ovarian follicle development; positive regulation of MAPKKK cascade; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; angiogenesis; vasculogenesis; endothelial cell differentiation; cell fate commitment; embryonic hemopoiesis; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of angiogenesis; cell migration during sprouting angiogenesis; branching morphogenesis of a tube; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; lymph vessel development; alveolus development; surfactant homeostasis; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis; positive regulation of nitric-oxide synthase biosynthetic process; positive regulation of cell migration

Disease: Hemangioma, Capillary Infantile