Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RING Finger Protein 212 Monoclonal Antibody | anti-RNF212 antibody

RING Finger Protein 212 (RNF212, Probable E3 SUMO-protein Ligase RNF212, ZHP3) (FITC)

Gene Names
RNF212; ZHP3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 212; Monoclonal Antibody; RING Finger Protein 212 (RNF212; Probable E3 SUMO-protein Ligase RNF212; ZHP3) (FITC); EC=6.3.2.-; anti-RNF212 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5H3
Specificity
Recognizes human RNF212.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RNF212 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa133-233 from human RNF212 (NP_919420) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMAPCARRVCHFQRFTMFLHRRLSSLAAPPSVQFWKARGTHQL*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of RNF212 expression in transfected 293T cell line by RNF212 monoclonal antibody. Lane 1: RNF212 transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RNF212 expression in transfected 293T cell line by RNF212 monoclonal antibody. Lane 1: RNF212 transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-RNF212 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
probable E3 SUMO-protein ligase RNF212 isoform b
NCBI Official Synonym Full Names
ring finger protein 212
NCBI Official Symbol
RNF212
NCBI Official Synonym Symbols
ZHP3
NCBI Protein Information
probable E3 SUMO-protein ligase RNF212
UniProt Protein Name
Probable E3 SUMO-protein ligase RNF212
Protein Family
UniProt Gene Name
RNF212
UniProt Entry Name
RN212_HUMAN

NCBI Description

This gene encodes a RING finger protein that may function as a ubiquitin ligase. The encoded protein may be involved in meiotic recombination. This gene is located within a linkage disequilibrium block and polymorphisms in this gene may influence recombination rates. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2010]

Research Articles on RNF212

Similar Products

Product Notes

The RNF212 rnf212 (Catalog #AAA6149387) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 212 (RNF212, Probable E3 SUMO-protein Ligase RNF212, ZHP3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 212 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF212 rnf212 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 212, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.