Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged KDR is approximately 1ng/ml as a capture antibody.)

Mouse KDR Monoclonal Antibody | anti-KDR antibody

KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase), CD309, FLK1, VEGFR, VEGFR2) (AP)

Gene Names
KDR; FLK1; CD309; VEGFR; VEGFR2
Applications
Western Blot
Purity
Purified
Synonyms
KDR; Monoclonal Antibody; KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase); CD309; FLK1; VEGFR; VEGFR2) (AP); Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase); VEGFR2; anti-KDR antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F1
Specificity
Recognizes KDR.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-KDR antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KDR (NP_002244, 31aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged KDR is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KDR is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-KDR antibody
Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas. [provided by RefSeq]
Product Categories/Family for anti-KDR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110.5kDa (987aa) 100-150KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
vascular endothelial growth factor receptor 2
NCBI Official Synonym Full Names
kinase insert domain receptor
NCBI Official Symbol
KDR
NCBI Official Synonym Symbols
FLK1; CD309; VEGFR; VEGFR2
NCBI Protein Information
vascular endothelial growth factor receptor 2
UniProt Protein Name
Vascular endothelial growth factor receptor 2
UniProt Gene Name
KDR
UniProt Synonym Gene Names
FLK1; VEGFR2; VEGFR-2; FLK-1; KDR
UniProt Entry Name
VGFR2_HUMAN

NCBI Description

Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas. [provided by RefSeq, May 2009]

Uniprot Description

VEGFR2: a receptor tyrosine kinase of the VEGFR family. High affinity receptor for VEGF and VEGF-C. Ligand binding induces autophosphorylation and activation. Activated receptor recruits proteins including Shc, GRB2, PI3K, Nck, SHP-1 and SHP-2. Plays a key role in vascular development and regulation of vascular permeability.

Protein type: Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); Protein kinase, TK; EC 2.7.10.1; TK group; VEGFR family

Chromosomal Location of Human Ortholog: 4q11-q12

Cellular Component: Golgi apparatus; integral to plasma membrane; endoplasmic reticulum; early endosome; cytoplasmic membrane-bound vesicle; extracellular region; plasma membrane; cell junction; nucleus; endosome; external side of plasma membrane; lipid raft

Molecular Function: integrin binding; vascular endothelial growth factor receptor activity; protein binding; growth factor binding; protein-tyrosine kinase activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; Hsp90 protein binding; ATP binding

Biological Process: extracellular matrix organization and biogenesis; positive regulation of positive chemotaxis; peptidyl-tyrosine phosphorylation; viral reproduction; protein amino acid autophosphorylation; cell maturation; calcium ion homeostasis; regulation of cell shape; positive regulation of focal adhesion formation; ovarian follicle development; positive regulation of MAPKKK cascade; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; angiogenesis; vasculogenesis; endothelial cell differentiation; cell fate commitment; embryonic hemopoiesis; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of angiogenesis; cell migration during sprouting angiogenesis; branching morphogenesis of a tube; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; lymph vessel development; alveolus development; surfactant homeostasis; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis; positive regulation of nitric-oxide synthase biosynthetic process; positive regulation of cell migration

Disease: Hemangioma, Capillary Infantile

Research Articles on KDR

Similar Products

Product Notes

The KDR kdr (Catalog #AAA6161632) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KDR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KDR kdr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KDR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.