Mouse anti-Human KCNJ10 Monoclonal Antibody | anti-KCNJ10 antibody

KCNJ10 (ATP-sensitive Inward Rectifier Potassium Channel 10, ATP-dependent Inwardly Rectifying Potassium Channel Kir4.1, Inward Rectifier K(+) Channel Kir1.2, Potassium Channel, Inwardly Rectifying Subfamily J Member 10) (PE)

Cat. Num. AAA6158482

• Gene Names: KCNJ10; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KCNJ10; Monoclonal Antibody; KCNJ10 (ATP-sensitive Inward Rectifier Potassium Channel 10; ATP-dependent Inwardly Rectifying Potassium Channel Kir4.1; Inward Rectifier K(+) Channel Kir1.2; Potassium Channel; Inwardly Rectifying Subfamily J Member 10) (PE); anti-KCNJ10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C11
• Specificity: Recognizes human KCNJ10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 379

• Applicable Applications for anti-KCNJ10 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa276-379 rom human KCNJ10 (NP_002232) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.18kD).)

Testing Data

(Detection limit for recombinant GST tagged KCNJ10 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-KCNJ10 antibody

This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.

Product Categories/Family for anti-KCNJ10 antibody

Antibodies; Ion Channel

References

1. Free radical stress-mediated loss of Kcnj10 protein expression in stria vascularis contributes to deafness in Pendred syndrome mouse model. Singh R, Wangemann P.Am J Physiol Renal Physiol. 2008 Jan;294(1):F139-48. Epub 2007 Oct 24.

NCBI and Uniprot Product Information

• NCBI GI #: 25121966
• NCBI GeneID: 3766
• NCBI Accession #: NP_002232
• NCBI GenBank Nucleotide #: NM_002241
• UniProt Accession #: P78508
• NCBI Official Full Name: ATP-sensitive inward rectifier potassium channel 10
• NCBI Official Synonym Full Names: potassium inwardly rectifying channel subfamily J member 10
• NCBI Official Symbol: KCNJ10
• NCBI Official Synonym Symbols: KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN
• NCBI Protein Information: ATP-sensitive inward rectifier potassium channel 10
• UniProt Protein Name: ATP-sensitive inward rectifier potassium channel 10
• Protein Family: ATP-sensitive inward rectifier potassium channel
• UniProt Gene Name: KCNJ10

NCBI Description

This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq, Jul 2008]

Uniprot Description

May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (). In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules.