Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Mouse anti-Human KCNJ10 Monoclonal Antibody | anti-KCNJ10 antibody

KCNJ10 (ATP-sensitive Inward Rectifier Potassium Channel 10, ATP-dependent Inwardly Rectifying Potassium Channel Kir4.1, Inward Rectifier K(+) Channel Kir1.2, Potassium Channel, Inwardly Rectifying Subfamily J Member 10) (FITC)

Gene Names
KCNJ10; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNJ10; Monoclonal Antibody; KCNJ10 (ATP-sensitive Inward Rectifier Potassium Channel 10; ATP-dependent Inwardly Rectifying Potassium Channel Kir4.1; Inward Rectifier K(+) Channel Kir1.2; Potassium Channel; Inwardly Rectifying Subfamily J Member 10) (FITC); anti-KCNJ10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C11
Specificity
Recognizes human KCNJ10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
379
Applicable Applications for anti-KCNJ10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa276-379 rom human KCNJ10 (NP_002232) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.18kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Testing Data

(Detection limit for recombinant GST tagged KCNJ10 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KCNJ10 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-KCNJ10 antibody
This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.
Product Categories/Family for anti-KCNJ10 antibody
References
1. Free radical stress-mediated loss of Kcnj10 protein expression in stria vascularis contributes to deafness in Pendred syndrome mouse model. Singh R, Wangemann P.Am J Physiol Renal Physiol. 2008 Jan;294(1):F139-48. Epub 2007 Oct 24.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 10
NCBI Official Synonym Full Names
potassium inwardly rectifying channel subfamily J member 10
NCBI Official Symbol
KCNJ10
NCBI Official Synonym Symbols
KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 10
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 10
UniProt Gene Name
KCNJ10

NCBI Description

This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq, Jul 2008]

Uniprot Description

May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (). In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules.

Research Articles on KCNJ10

Similar Products

Product Notes

The KCNJ10 kcnj10 (Catalog #AAA6147876) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNJ10 (ATP-sensitive Inward Rectifier Potassium Channel 10, ATP-dependent Inwardly Rectifying Potassium Channel Kir4.1, Inward Rectifier K(+) Channel Kir1.2, Potassium Channel, Inwardly Rectifying Subfamily J Member 10) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNJ10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNJ10 kcnj10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNJ10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.