Mouse anti-Human STON1 Monoclonal Antibody | anti-STON1 antibody

STON1 (Stonin-1, Stoned B-like Factor, SALF, SBLF, STN1, DKFZp781K2462, MGC149803, MGC149804) (Biotin)

Cat. Num. AAA6144649

• Gene Names: STON1; SALF; SBLF; STN1; STNB1
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STON1; Monoclonal Antibody; STON1 (Stonin-1; Stoned B-like Factor; SALF; SBLF; STN1; DKFZp781K2462; MGC149803; MGC149804) (Biotin); anti-STON1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F3
• Specificity: Recognizes human SBLF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 735

• Applicable Applications for anti-STON1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa529-621 from human SBLF (NP_006864) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged STON1 is 1ng/ml as a capture antibody.)

Related Product Information for anti-STON1 antibody

This protein may be involved in the endocytic machinery.

Product Categories/Family for anti-STON1 antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 26787993
• NCBI GeneID: 11037
• NCBI Accession #: NP_006864
• NCBI GenBank Nucleotide #: NM_006873
• UniProt Accession #: Q9Y6Q2
• NCBI Official Full Name: stonin-1
• NCBI Official Synonym Full Names: stonin 1
• NCBI Official Symbol: STON1
• NCBI Official Synonym Symbols: SALF; SBLF; STN1; STNB1
• NCBI Protein Information: stonin-1
• UniProt Protein Name: Stonin-1
• Protein Family: Stonin
• UniProt Gene Name: STON1
• UniProt Synonym Gene Names: SALF; SBLF; STN1
• UniProt Entry Name: STON1_HUMAN

NCBI Description

Endocytosis of cell surface proteins is mediated by a complex molecular machinery that assembles on the inner surface of the plasma membrane. This gene encodes one of two human homologs of the Drosophila melanogaster stoned B protein. This protein is related to components of the endocytic machinery and exhibits a modular structure consisting of an N-terminal proline-rich domain, a central region of homology specific to the human stoned B-like proteins, and a C-terminal region homologous to the mu subunits of adaptor protein (AP) complexes. Read-through transcription of this gene into the neighboring downstream gene, which encodes TFIIA-alpha/beta-like factor, generates a transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010]

Uniprot Description

STON1: May be involved in the endocytic machinery. Belongs to the Stoned B family.

Chromosomal Location of Human Ortholog: 2p16.3

Cellular Component: clathrin adaptor complex

Biological Process: intracellular protein transport; regulation of endocytosis; endocytosis