Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse Integrin alpha 3A Monoclonal Antibody | anti-Itga3 antibody

Mouse monoclonal Integrin alpha 3A antibody

Gene Names
Itga3; CD49C; GAPB3; AA407068
Applications
Immunohistochemistry, Western Blot
Synonyms
Integrin alpha 3A; Monoclonal Antibody; Mouse monoclonal Integrin alpha 3A antibody; Integrin alpha 3A antibody; anti-Itga3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a
Clone Number
158A3
Specificity
Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A
Form/Format
Supplied in PBS containing 0.09% sodium azide
Sequence Length
141
Applicable Applications for anti-Itga3 antibody
Immunohistochemistry (IHC) Formalin, Western Blot (WB)
Application Notes
IHC: 1:100-1:200
WB: 1:100-1:1000
Immunogen
Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen.
Cross-Reactivity
Human
Product Categories/Family for anti-Itga3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
113,428 Da
NCBI Official Full Name
integrin alpha 3A, partial
NCBI Official Synonym Full Names
integrin alpha 3
NCBI Official Symbol
Itga3
NCBI Official Synonym Symbols
CD49C; GAPB3; AA407068
NCBI Protein Information
integrin alpha-3
UniProt Protein Name
Integrin alpha-3
Protein Family
UniProt Gene Name
Itga3
UniProt Synonym Gene Names
GAPB3

NCBI Description

This gene encodes a subunit of integrin family of cell surface proteins. The encoded protein undergoes post-translational processing to form a disulfide bond-linked dimer comprised of heavy and light chains. At the cell surface, the encoded protein non-covalently associates with the integrin beta-1 subunit to form a heterodimer that interacts with many extracellular matrix proteins including fibronectin and laminin. Mice lacking the encoded protein die during the first day after birth due to severe abnormalities in kidneys. Mice lacking the encoded protein specifically in the basal layer of epidermis display several skin defects and accelerated wound healing. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

ITGA3: an integral membrane protein that heterodimerizes with a beta chain, forming a receptor for many extracellular-matrix proteins including fibronectin, laminin, collagen, epiligrin and thrombospondin. Undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1. Two alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, misc.

Chromosomal Location of Human Ortholog: 11 D|11 59.01 cM

Cellular Component: basolateral plasma membrane; cell surface; excitatory synapse; external side of plasma membrane; filopodium membrane; focal adhesion; growth cone; perinuclear region of cytoplasm; plasma membrane; receptor complex; synapse

Molecular Function: collagen binding; fibronectin binding; glycoprotein binding; integrin binding; laminin binding; protease binding; protein binding; protein domain specific binding; protein heterodimerization activity

Biological Process: cell adhesion; fusion of sperm to egg plasma membrane; lung development; memory; negative regulation of cell projection organization and biogenesis; negative regulation of Rho protein signal transduction; neuron migration; regulation of BMP signaling pathway; regulation of transforming growth factor beta receptor signaling pathway; regulation of Wnt receptor signaling pathway; skin development

Research Articles on Itga3

Similar Products

Product Notes

The Itga3 itga3 (Catalog #AAA5306516) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Integrin alpha 3A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC) Formalin, Western Blot (WB). IHC: 1:100-1:200 WB: 1:100-1:1000. Researchers should empirically determine the suitability of the Itga3 itga3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Integrin alpha 3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.