Mouse anti-Human IL27RA Monoclonal Antibody | anti-IL27RA antibody

IL27RA (Interleukin 27 Receptor alpha, Interleukin-27 Receptor Subunit alpha, IL-27 Receptor Subunit alpha, IL-27R Subunit alpha, IL-27R-alpha, IL27RA, IL-27RA, IL27R, Cytokine Receptor WSX-1, Cytokine Receptor-like 1, CRL1, Type I T-cell Cytokine Recepto

Cat. Num. AAA6158375

• Gene Names: IL27RA; CRL1; TCCR; WSX1; IL27R; IL-27RA; zcytor1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL27RA; Monoclonal Antibody; IL27RA (Interleukin 27 Receptor alpha; Interleukin-27 Receptor Subunit alpha; IL-27 Receptor Subunit alpha; IL-27R Subunit alpha; IL-27R-alpha; IL-27RA; IL27R; Cytokine Receptor WSX-1; Cytokine Receptor-like 1; CRL1; Type I T-cell Cytokine Recepto; anti-IL27RA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 8G9
• Specificity: Recognizes human IL27RA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-IL27RA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa33-132 from IL27RA (NP_004834) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-IL27RA antibody

Upon antigen challenge, T-helper cells differentiate into two functional distinct subsets, Th1 and Th2. Th1 cells produce IL-2, IFN-g and lymphotoxin-b that augment cell mediated immune response while Th2 cells secrete IL-4, IL-5, and IL-10 that enhance humoral immunity. The function of T-helper cells is regulated by cytokines. A novel cytokine receptor was recently identified and cloned. It is a new member in the type I cytokine receptor family and designated TCCR for T-cell cytokine receptor and WSX-1. TCCR deficient mice had impaired Th1 responses to protein antigen challenge, including decreased levels of IFN-g and Th1-dependent antibody IgG2a. TCCR is predominately expressed in thymus, spleen, lymph notes and peripheral blood leukocytes.

Product Categories/Family for anti-IL27RA antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4759328
• NCBI GeneID: 9466
• NCBI Accession #: NP_004834
• NCBI GenBank Nucleotide #: NM_004843
• UniProt Accession #: Q6UWB1; O60624; A0N0L1
• Molecular Weight: 70 kDa
• NCBI Official Full Name: interleukin-27 receptor subunit alpha
• NCBI Official Synonym Full Names: interleukin 27 receptor, alpha
• NCBI Official Symbol: IL27RA
• NCBI Official Synonym Symbols: CRL1; TCCR; WSX1; IL27R; IL-27RA; zcytor1
• NCBI Protein Information: interleukin-27 receptor subunit alpha; IL-27R-alpha; IL-27R subunit alpha; cytokine receptor WSX-1; cytokine receptor-like 1; class I cytokine receptor; IL-27 receptor subunit alpha; T-cell cytokine receptor type 1; type I T-cell cytokine receptor
• UniProt Protein Name: Interleukin-27 receptor subunit alpha
• Protein Family: Interleukin-27 receptor
• UniProt Gene Name: IL27RA
• UniProt Synonym Gene Names: CRL1; TCCR; WSX1; IL-27 receptor subunit alpha; IL-27R subunit alpha; IL-27R-alpha; IL-27RA; TCCR
• UniProt Entry Name: I27RA_HUMAN

NCBI Description

In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most antibody responses. Mice deficient in these cytokines, their receptors, or associated transcription factors have impaired, but are not absent of, Th1 or Th2 immune responses. This gene encodes a protein which is similar to the mouse T-cell cytokine receptor Tccr at the amino acid level, and is predicted to be a glycosylated transmembrane protein. [provided by RefSeq, Jul 2008]

Uniprot Description

IL27RA: Receptor for IL27. Requires IL6ST/gp130 to mediate signal transduction in response to IL27. This signaling system acts through STAT3 and STAT1. Involved in the regulation of Th1- type immune responses. Also appears to be involved in innate defense mechanisms. Belongs to the type I cytokine receptor family. Type 2 subfamily.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: integral to plasma membrane

Molecular Function: interleukin-27 receptor activity; transmembrane receptor activity

Biological Process: defense response to Gram-positive bacterium; positive regulation of interferon-gamma production; cell surface receptor linked signal transduction; positive regulation of T-helper 1 type immune response; negative regulation of T-helper 2 type immune response; immune response; regulation of isotype switching to IgG isotypes