Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human IL27RA Monoclonal Antibody | anti-IL27RA antibody

IL27RA (Interleukin 27 Receptor alpha, Interleukin-27 Receptor Subunit alpha, IL-27 Receptor Subunit alpha, IL-27R Subunit alpha, IL-27R-alpha, IL27RA, IL-27RA, IL27R, Cytokine Receptor WSX-1, Cytokine Receptor-like 1, CRL1, Type I T-cell Cytokine Recepto

Gene Names
IL27RA; CRL1; TCCR; WSX1; IL27R; IL-27RA; zcytor1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL27RA; Monoclonal Antibody; IL27RA (Interleukin 27 Receptor alpha; Interleukin-27 Receptor Subunit alpha; IL-27 Receptor Subunit alpha; IL-27R Subunit alpha; IL-27R-alpha; IL-27RA; IL27R; Cytokine Receptor WSX-1; Cytokine Receptor-like 1; CRL1; Type I T-cell Cytokine Recepto; anti-IL27RA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
8G9
Specificity
Recognizes human IL27RA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-IL27RA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa33-132 from IL27RA (NP_004834) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-IL27RA antibody
Upon antigen challenge, T-helper cells differentiate into two functional distinct subsets, Th1 and Th2. Th1 cells produce IL-2, IFN-g and lymphotoxin-b that augment cell mediated immune response while Th2 cells secrete IL-4, IL-5, and IL-10 that enhance humoral immunity. The function of T-helper cells is regulated by cytokines. A novel cytokine receptor was recently identified and cloned. It is a new member in the type I cytokine receptor family and designated TCCR for T-cell cytokine receptor and WSX-1. TCCR deficient mice had impaired Th1 responses to protein antigen challenge, including decreased levels of IFN-g and Th1-dependent antibody IgG2a. TCCR is predominately expressed in thymus, spleen, lymph notes and peripheral blood leukocytes.
Product Categories/Family for anti-IL27RA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 kDa
NCBI Official Full Name
interleukin-27 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 27 receptor, alpha
NCBI Official Symbol
IL27RA
NCBI Official Synonym Symbols
CRL1; TCCR; WSX1; IL27R; IL-27RA; zcytor1
NCBI Protein Information
interleukin-27 receptor subunit alpha; IL-27R-alpha; IL-27R subunit alpha; cytokine receptor WSX-1; cytokine receptor-like 1; class I cytokine receptor; IL-27 receptor subunit alpha; T-cell cytokine receptor type 1; type I T-cell cytokine receptor
UniProt Protein Name
Interleukin-27 receptor subunit alpha
Protein Family
UniProt Gene Name
IL27RA
UniProt Synonym Gene Names
CRL1; TCCR; WSX1; IL-27 receptor subunit alpha; IL-27R subunit alpha; IL-27R-alpha; IL-27RA; TCCR
UniProt Entry Name
I27RA_HUMAN

NCBI Description

In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most antibody responses. Mice deficient in these cytokines, their receptors, or associated transcription factors have impaired, but are not absent of, Th1 or Th2 immune responses. This gene encodes a protein which is similar to the mouse T-cell cytokine receptor Tccr at the amino acid level, and is predicted to be a glycosylated transmembrane protein. [provided by RefSeq, Jul 2008]

Uniprot Description

IL27RA: Receptor for IL27. Requires IL6ST/gp130 to mediate signal transduction in response to IL27. This signaling system acts through STAT3 and STAT1. Involved in the regulation of Th1- type immune responses. Also appears to be involved in innate defense mechanisms. Belongs to the type I cytokine receptor family. Type 2 subfamily.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: integral to plasma membrane

Molecular Function: interleukin-27 receptor activity; transmembrane receptor activity

Biological Process: defense response to Gram-positive bacterium; positive regulation of interferon-gamma production; cell surface receptor linked signal transduction; positive regulation of T-helper 1 type immune response; negative regulation of T-helper 2 type immune response; immune response; regulation of isotype switching to IgG isotypes

Research Articles on IL27RA

Similar Products

Product Notes

The IL27RA il27ra (Catalog #AAA6147769) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL27RA (Interleukin 27 Receptor alpha, Interleukin-27 Receptor Subunit alpha, IL-27 Receptor Subunit alpha, IL-27R Subunit alpha, IL-27R-alpha, IL27RA, IL-27RA, IL27R, Cytokine Receptor WSX-1, Cytokine Receptor-like 1, CRL1, Type I T-cell Cytokine Recepto reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL27RA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL27RA il27ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL27RA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.