Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human IL1RAPL1 Monoclonal Antibody | anti-IL1RAPL1 antibody

IL1RAPL1 (Interleukin-1 Receptor Accessory Protein-like 1, IL-1-RAPL-1, IL-1RAPL-1, IL1RAPL-1, Oligophrenin-4, Three Immunoglobulin Domain-containing IL-1 Receptor-related 2, TIGIRR-2, X-linked Interleukin-1 Receptor Accessory Protein-like 1, OPHN4) (MaxL

Gene Names
IL1RAPL1; IL1R8; MRX10; MRX21; MRX34; OPHN4; IL1RAPL; TIGIRR-2; IL1RAPL-1; IL-1RAPL-1; IL-1-RAPL-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL1RAPL1; Monoclonal Antibody; IL1RAPL1 (Interleukin-1 Receptor Accessory Protein-like 1; IL-1-RAPL-1; IL-1RAPL-1; IL1RAPL-1; Oligophrenin-4; Three Immunoglobulin Domain-containing IL-1 Receptor-related 2; TIGIRR-2; X-linked Interleukin-1 Receptor Accessory Protein-like 1; OPHN4) (MaxL; anti-IL1RAPL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C10
Specificity
Recognizes human IL1RAPL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
3615
Applicable Applications for anti-IL1RAPL1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa151-251 from IL1RAPL1 (NP_055086) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IL1RAPL1 antibody
May regulate secretion and presynaptic differentiation through inhibition of the activity of N-type voltage-gated calcium channel. May activate the MAP kinase JNK. Plays a role in presynaptic and postsynaptic differentiation and dendritic spine formation in neurons.
Product Categories/Family for anti-IL1RAPL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens interleukin 1 receptor accessory protein like 1 (IL1RAPL1), mRNA
NCBI Official Synonym Full Names
interleukin 1 receptor accessory protein like 1
NCBI Official Symbol
IL1RAPL1
NCBI Official Synonym Symbols
IL1R8; MRX10; MRX21; MRX34; OPHN4; IL1RAPL; TIGIRR-2; IL1RAPL-1; IL-1RAPL-1; IL-1-RAPL-1
NCBI Protein Information
interleukin-1 receptor accessory protein-like 1
UniProt Protein Name
Interleukin-1 receptor accessory protein-like 1
UniProt Gene Name
IL1RAPL1
UniProt Synonym Gene Names
OPHN4; IL-1-RAPL-1; IL-1RAPL-1; IL1RAPL-1; TIGIRR-2
UniProt Entry Name
IRPL1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 receptor family and is similar to the interleukin 1 accessory proteins. This protein has an N-terminal signal peptide, three extracellular immunoglobulin Ig-like domains, a transmembrane domain, an intracellular Toll/IL-1R domain, and a long C-terminal tail which interacts with multiple signalling molecules. This gene is located at a region on chromosome X that is associated with a non-syndromic form of X-linked intellectual disability. Deletions and mutations in this gene were found in patients with intellectual disability. This gene is expressed at a high level in post-natal brain structures involved in the hippocampal memory system, which suggests a specialized role in the physiological processes underlying memory and learning abilities, and plays a role in synapse formation and stabilization. [provided by RefSeq, Jul 2017]

Uniprot Description

IL1RAPL1: May regulate secretion and presynaptic differentiation through inhibition of the activity of N-type voltage-gated calcium channel. May activate the MAP kinase JNK. Plays a role in presynaptic and postsynaptic differentiation and dendritic spine formation in neurons. Defects in IL1RAPL1 are the cause of mental retardation X-linked type 21 (MRX21). Mental retardation is a mental disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non- syndromic mental retardation patients do not manifest other clinical signs. Belongs to the interleukin-1 receptor family. 1 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: Xp22.1-p21.3

Cellular Component: postsynaptic membrane; cell surface; axon; cytoplasm; dendrite; plasma membrane; integral to membrane

Molecular Function: voltage-gated calcium channel activity; protein binding; interleukin-1 binding; receptor binding

Biological Process: heterophilic cell adhesion; neuron differentiation; negative regulation of exocytosis; positive regulation of dendrite morphogenesis; signal transduction

Disease: Mental Retardation, X-linked 21

Research Articles on IL1RAPL1

Similar Products

Product Notes

The IL1RAPL1 il1rapl1 (Catalog #AAA6190717) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL1RAPL1 (Interleukin-1 Receptor Accessory Protein-like 1, IL-1-RAPL-1, IL-1RAPL-1, IL1RAPL-1, Oligophrenin-4, Three Immunoglobulin Domain-containing IL-1 Receptor-related 2, TIGIRR-2, X-linked Interleukin-1 Receptor Accessory Protein-like 1, OPHN4) (MaxL reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1RAPL1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1RAPL1 il1rapl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1RAPL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.