Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human IL1B Monoclonal Antibody | anti-IL1B antibody

IL1B (Interleukin-1 beta, IL-1 beta, Catabolin, IL1F2) (HRP)

Gene Names
IL1B; IL-1; IL1F2; IL1-BETA
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL1B; Monoclonal Antibody; IL1B (Interleukin-1 beta; IL-1 beta; Catabolin; IL1F2) (HRP); anti-IL1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A8
Specificity
Recognizes human IL1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-IL1B antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa170-269 from human IL1B (AAH08678) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(IL1B monoclonal antibody. Western Blot analysis of IL1B expression in human liver.)

Western Blot (WB) (IL1B monoclonal antibody. Western Blot analysis of IL1B expression in human liver.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IL1B on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to IL1B on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IL1B is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL1B is ~10ng/ml as a capture antibody.)
Product Categories/Family for anti-IL1B antibody
References
1. Upregulation of MMP-13 via Runx2 in the stromal cell of Giant Cell Tumor. Mak IW, Cowan RW, Popovic S, Colterjohn N, Singh G, Ghert M.Bone. 2009 Aug;45(2):377-86. Epub 2009 May 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,748 Da
NCBI Official Full Name
Homo sapiens interleukin 1, beta, mRNA
NCBI Official Synonym Full Names
interleukin 1 beta
NCBI Official Symbol
IL1B
NCBI Official Synonym Symbols
IL-1; IL1F2; IL1-BETA
NCBI Protein Information
interleukin-1 beta
Protein Family

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008]

Research Articles on IL1B

Similar Products

Product Notes

The IL1B (Catalog #AAA6153061) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL1B (Interleukin-1 beta, IL-1 beta, Catabolin, IL1F2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.