Mouse IL15 Monoclonal Antibody | anti-IL15 antibody

IL15 (Interleukin 15, IL-15, MGC9721) (PE)

Cat. Num. AAA6184564

• Gene Names: IL15; IL-15
• Applications: ELISA, Immunofluorescence
• Purity: Purified
• Synonyms: IL15; Monoclonal Antibody; IL15 (Interleukin 15; IL-15; MGC9721) (PE); Interleukin 15; MGC9721; anti-IL15 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A4
• Specificity: Recognizes IL15.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-IL15 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IL15 (NP_000576, 49aa-162aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IL15 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IL15 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-IL15 antibody

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. [provided by RefSeq]

Product Categories/Family for anti-IL15 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 10835153
• NCBI GeneID: 3600
• NCBI Accession #: NP_000576
• NCBI GenBank Nucleotide #: NM_000585.4
• UniProt Accession #: P40933; O00440; O43512; Q495Z8; Q6FGX7; Q93058; Q9UBA3; D3DNZ2
• Molecular Weight: 18 kDa
• NCBI Official Full Name: interleukin-15 isoform 1 preproprotein
• NCBI Official Synonym Full Names: interleukin 15
• NCBI Official Symbol: IL15
• NCBI Official Synonym Symbols: IL-15
• NCBI Protein Information: interleukin-15
• UniProt Protein Name: Interleukin-15
• Protein Family: Interleukin
• UniProt Gene Name: IL15
• UniProt Synonym Gene Names: IL-15
• UniProt Entry Name: IL15_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011]