Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human IFI6 Monoclonal Antibody | anti-IFI6 antibody

IFI6 (Interferon alpha-inducible Protein 6, Interferon-induced Protein 6-16, Ifi-6-16, G1P3)

Gene Names
IFI6; 6-16; G1P3; FAM14C; IFI616; IFI-6-16
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
IFI6; Monoclonal Antibody; IFI6 (Interferon alpha-inducible Protein 6; Interferon-induced Protein 6-16; Ifi-6-16; G1P3); Anti -IFI6 (Interferon alpha-inducible Protein 6; anti-IFI6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
M2
Specificity
Recognizes human G1P3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
Applicable Applications for anti-IFI6 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full length recombinant corresponding to aa1-130 from human G1P3 (AAH11601) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-IFI6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,927 Da
NCBI Official Full Name
interferon alpha-inducible protein 6 isoform a
NCBI Official Synonym Full Names
interferon, alpha-inducible protein 6
NCBI Official Symbol
IFI6
NCBI Official Synonym Symbols
6-16; G1P3; FAM14C; IFI616; IFI-6-16
NCBI Protein Information
interferon alpha-inducible protein 6; interferon-induced protein 6-16; interferon, alpha-inducible protein clone IFI-6-16
UniProt Protein Name
Interferon alpha-inducible protein 6
UniProt Gene Name
IFI6
UniProt Synonym Gene Names
G1P3; Ifi-6-16
UniProt Entry Name
IFI6_HUMAN

NCBI Description

This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

IFI6: first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, multi-pass; Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p35

Cellular Component: mitochondrion; plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: release of cytochrome c from mitochondria; cytokine and chemokine mediated signaling pathway; immune response; negative regulation of caspase activity; negative regulation of mitochondrial depolarization

Research Articles on IFI6

Similar Products

Product Notes

The IFI6 ifi6 (Catalog #AAA644765) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFI6 (Interferon alpha-inducible Protein 6, Interferon-induced Protein 6-16, Ifi-6-16, G1P3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFI6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the IFI6 ifi6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRQKAVSLFL CYLLLFTCSG VEAGKKKCSE SSDSGSGFWK ALTFMAVGGG LAVAGLPALG FTGAGIAANS VAASLMSWSA ILNGGGVPAG GLVATLQSLG AGGSSVVIGN IGALMGYATH KYLDSEEDEE. It is sometimes possible for the material contained within the vial of "IFI6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.