Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ID3 monoclonal antibody (M03), clone 2H8 Western Blot analysis of ID3 expression in HeLa.)

Mouse ID3 Monoclonal Antibody | anti-ID3 antibody

ID3 (Inhibitor of DNA Binding 3, Dominant Negative Helix-loop-Helix Protein, HEIR-1, bHLHb25) (AP)

Gene Names
ID3; HEIR-1; bHLHb25
Applications
Western Blot
Purity
Purified
Synonyms
ID3; Monoclonal Antibody; ID3 (Inhibitor of DNA Binding 3; Dominant Negative Helix-loop-Helix Protein; HEIR-1; bHLHb25) (AP); Inhibitor of DNA Binding 3; bHLHb25; anti-ID3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H8
Specificity
Recognizes ID3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ID3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ID3 (NP_002158, 1aa-83aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ID3 monoclonal antibody (M03), clone 2H8 Western Blot analysis of ID3 expression in HeLa.)

Western Blot (WB) (ID3 monoclonal antibody (M03), clone 2H8 Western Blot analysis of ID3 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ID3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ID3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ID3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ID3 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ID3 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ID3 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-ID3 antibody
Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA. [supplied by OMIM]
Product Categories/Family for anti-ID3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,999 Da
NCBI Official Full Name
DNA-binding protein inhibitor ID-3
NCBI Official Synonym Full Names
inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
NCBI Official Symbol
ID3
NCBI Official Synonym Symbols
HEIR-1; bHLHb25
NCBI Protein Information
DNA-binding protein inhibitor ID-3
UniProt Protein Name
DNA-binding protein inhibitor ID-3
UniProt Gene Name
ID3
UniProt Synonym Gene Names
1R21; BHLHB25; HEIR1
UniProt Entry Name
ID3_HUMAN

NCBI Description

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011]

Uniprot Description

ID3: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors. Induced by phorbol 12-myristate 13-acetate (PMA). Interacts with COPS5 and COPS7A. Homodimer, and heterodimer with other HLH proteins.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 1p36.13-p36.12

Cellular Component: microtubule cytoskeleton; nucleoplasm; cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein domain specific binding; protein binding; transcription factor binding; transcription factor activity; transcription corepressor activity

Biological Process: circadian rhythm; muscle development; central nervous system development; transcription, DNA-dependent; positive regulation of apoptosis; regulation of cell cycle; heart development; multicellular organismal development; negative regulation of transcription factor activity; negative regulation of transcription from RNA polymerase II promoter; notochord development; neuron differentiation; odontogenesis; epithelial cell differentiation; response to wounding; negative regulation of osteoblast differentiation; negative regulation of myoblast differentiation; negative regulation of transcription, DNA-dependent; metanephros development; regulation of DNA replication

Research Articles on ID3

Similar Products

Product Notes

The ID3 id3 (Catalog #AAA6162741) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ID3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ID3 id3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ID3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.