Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human HMOX1 Monoclonal Antibody | anti-HMOX1 antibody

HMOX1 (Heme Oxygenase-1, Heme Oxygenase 1, HO-1, HO, HO1) (Biotin)

Gene Names
HMOX1; HO-1; HSP32; HMOX1D; bK286B10
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HMOX1; Monoclonal Antibody; HMOX1 (Heme Oxygenase-1; Heme Oxygenase 1; HO-1; HO; HO1) (Biotin); anti-HMOX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C6
Specificity
Recognizes human HMOX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1554
Applicable Applications for anti-HMOX1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human HMOX1 (NM_002133) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged HMOX1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HMOX1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-HMOX1 antibody
Heme oxygenase (HO) is the rate-limiting enzyme in the catabolism of heme that results in the release of carbon monoxide, iron and biliverdin. The products of this enzymatic reaction play important biological roles in antioxidant, anti-inflammatory and cytoprotective functions. Heme oxyganse is comprised of two isozymes, includ-ing the constitutively expressed HO-2 isozyme and the inducible HO-1 isozyme. Inducible HO-1 is expressed as an adaptive response to several stimuli, including heme, metals and hormones. The induction of HO-1 has been implicated in numerous disease states, such as transplant rejection, hypertension, atherosclerosis, Alzheimer disease, endotoxic shock, diabetes, inflammation and neurological disorders.
Product Categories/Family for anti-HMOX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens heme oxygenase 1 (HMOX1), mRNA
NCBI Official Synonym Full Names
heme oxygenase 1
NCBI Official Symbol
HMOX1
NCBI Official Synonym Symbols
HO-1; HSP32; HMOX1D; bK286B10
NCBI Protein Information
heme oxygenase 1
UniProt Protein Name
Heme oxygenase 1
UniProt Gene Name
HMOX1
UniProt Synonym Gene Names
HO; HO1; HO-1
UniProt Entry Name
HMOX1_HUMAN

NCBI Description

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]

Uniprot Description

HMOX1: Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Heme oxygenase 1 activity is highly inducible by its substrate heme and by various non-heme substances such as heavy metals, bromobenzene, endotoxin, oxidizing agents and UVA. Expressed at higher levels in renal cancer tissue than in normal tissue. Belongs to the heme oxygenase family.

Protein type: EC 1.14.99.3; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; Oxidoreductase

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: extracellular space; endoplasmic reticulum membrane; membrane; perinuclear region of cytoplasm; endoplasmic reticulum; nucleolus; caveola; nucleus; cytosol

Molecular Function: protein binding; signal transducer activity; protein homodimerization activity; enzyme binding; metal ion binding; phospholipase D activity; heme binding; heme oxygenase (decyclizing) activity

Biological Process: cell death; response to nicotine; negative regulation of smooth muscle cell proliferation; cellular iron ion homeostasis; negative regulation of mast cell degranulation; positive regulation of smooth muscle cell proliferation; positive regulation of vasodilation; excretion; erythrocyte homeostasis; regulation of transcription factor activity; heme catabolic process; small GTPase mediated signal transduction; regulation of blood pressure; porphyrin metabolic process; negative regulation of mast cell cytokine production; angiogenesis; negative regulation of neuron apoptosis; regulation of transcription from RNA polymerase II promoter in response to oxidative stress; transmembrane transport; healing during inflammatory response; protein homooligomerization; positive regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of transcription factor activity; heme oxidation; cellular response to nutrient; regulation of angiogenesis; negative regulation of leukocyte migration; negative regulation of DNA binding; iron ion homeostasis; positive regulation of angiogenesis; positive regulation of chemokine biosynthetic process; DNA damage response, signal transduction resulting in induction of apoptosis; response to hydrogen peroxide; response to estrogen stimulus; endothelial cell proliferation; response to oxidative stress; smooth muscle hyperplasia

Disease: Heme Oxygenase 1 Deficiency; Pulmonary Disease, Chronic Obstructive

Research Articles on HMOX1

Similar Products

Product Notes

The HMOX1 hmox1 (Catalog #AAA6142307) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HMOX1 (Heme Oxygenase-1, Heme Oxygenase 1, HO-1, HO, HO1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HMOX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HMOX1 hmox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMOX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.