Mouse anti-Human HESX1 Monoclonal Antibody | anti-HESX1 antibody

HESX1 (Homeobox Expressed in ES Cells 1, Homeobox Protein ANF, hAnf, HANF, ANF, CPHD5, MGC138294) (PE)

Cat. Num. AAA6158172

• Gene Names: HESX1; ANF; RPX; CPHD5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HESX1; Monoclonal Antibody; HESX1 (Homeobox Expressed in ES Cells 1; Homeobox Protein ANF; hAnf; HANF; ANF; CPHD5; MGC138294) (PE); anti-HESX1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C4
• Specificity: Recognizes human HESX1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-HESX1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-111 from HESX1 (NP_003856) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged HESX1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-HESX1 antibody

Required for the normal development of the forebrain, eyes and other anterior structures such as the olfactory placodes and pituitary gland. Possible transcriptional repressor. Binds to the palindromic PIII sequence, 5'-AGCTTGAGTCTAATTGAATTAACTGTAC-3'. HESX1 and PROP1 bind as heterodimers on this palindromic site, and, in vitro, HESX1 can antagonize PROP1 activation.

Product Categories/Family for anti-HESX1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4504367
• NCBI GeneID: 8820
• NCBI Accession #: NP_003856.1
• NCBI GenBank Nucleotide #: NM_003865
• UniProt Accession #: Q9UBX0
• NCBI Official Full Name: homeobox expressed in ES cells 1
• NCBI Official Synonym Full Names: HESX homeobox 1
• NCBI Official Symbol: HESX1
• NCBI Official Synonym Symbols: ANF; RPX; CPHD5
• NCBI Protein Information: homeobox expressed in ES cells 1
• UniProt Protein Name: Homeobox expressed in ES cells 1
• Protein Family: Homeobox expressed in ES cells
• UniProt Gene Name: HESX1
• UniProt Synonym Gene Names: HANF; hAnf
• UniProt Entry Name: HESX1_HUMAN

NCBI Description

This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

HESX1: Required for the normal development of the forebrain, eyes and other anterior structures such as the olfactory placodes and pituitary gland. Possible transcriptional repressor. Binds to the palindromic PIII sequence, 5'-AGCTTGAGTCTAATTGAATTAACTGTAC-3'. HESX1 and PROP1 bind as heterodimers on this palindromic site, and, in vitro, HESX1 can antagonize PROP1 activation. Defects in HESX1 are a cause of septooptic dysplasia (SOD); also known as de Morsier syndrome. SOD is a rare autosomal recessive disease. SOD is characterized by optic nerve hypoplasia, absence of the corpus callosum and hypoplasia of the pituitary gland with panhypopopituitarism. Defects in HESX1 are a cause of growth hormone deficiency with pituitary anomalies (GHDPA). Defects in HESX1 are the cause of pituitary hormone deficiency combined type 5 (CPHD5). This disorder is manifested by deficiencies in anterior pituitary tropic hormones. week-old embryo. Belongs to the ANF homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 3p14.3

Cellular Component: nucleus

Molecular Function: protein C-terminus binding; protein binding; DNA binding; sequence-specific DNA binding; protein N-terminus binding; chromatin binding

Biological Process: transcription, DNA-dependent; brain development; otic vesicle formation; negative regulation of transcription, DNA-dependent; forebrain morphogenesis; nose development

Disease: Septooptic Dysplasia