Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human HESX1 Monoclonal Antibody | anti-HESX1 antibody

HESX1 (Homeobox Expressed in ES Cells 1, Homeobox Protein ANF, hAnf, HANF, ANF, CPHD5, MGC138294)

Gene Names
HESX1; ANF; RPX; CPHD5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HESX1; Monoclonal Antibody; HESX1 (Homeobox Expressed in ES Cells 1; Homeobox Protein ANF; hAnf; HANF; ANF; CPHD5; MGC138294); Anti -HESX1 (Homeobox Expressed in ES Cells 1; anti-HESX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C4
Specificity
Recognizes human HESX1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRR
Applicable Applications for anti-HESX1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-111 from HESX1 (NP_003856) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged HESX1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HESX1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-HESX1 antibody
Required for the normal development of the forebrain, eyes and other anterior structures such as the olfactory placodes and pituitary gland. Possible transcriptional repressor. Binds to the palindromic PIII sequence, 5'-AGCTTGAGTCTAATTGAATTAACTGTAC-3'. HESX1 and PROP1 bind as heterodimers on this palindromic site, and, in vitro, HESX1 can antagonize PROP1 activation.
Product Categories/Family for anti-HESX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,409 Da
NCBI Official Full Name
homeobox expressed in ES cells 1
NCBI Official Synonym Full Names
HESX homeobox 1
NCBI Official Symbol
HESX1
NCBI Official Synonym Symbols
ANF; RPX; CPHD5
NCBI Protein Information
homeobox expressed in ES cells 1; hAnf; homeobox protein ANF; Rathke pouch homeobox; homeobox, ES cell expressed 1
UniProt Protein Name
Homeobox expressed in ES cells 1
UniProt Gene Name
HESX1
UniProt Synonym Gene Names
HANF; hAnf
UniProt Entry Name
HESX1_HUMAN

NCBI Description

This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

HESX1: Required for the normal development of the forebrain, eyes and other anterior structures such as the olfactory placodes and pituitary gland. Possible transcriptional repressor. Binds to the palindromic PIII sequence, 5'-AGCTTGAGTCTAATTGAATTAACTGTAC-3'. HESX1 and PROP1 bind as heterodimers on this palindromic site, and, in vitro, HESX1 can antagonize PROP1 activation. Defects in HESX1 are a cause of septooptic dysplasia (SOD); also known as de Morsier syndrome. SOD is a rare autosomal recessive disease. SOD is characterized by optic nerve hypoplasia, absence of the corpus callosum and hypoplasia of the pituitary gland with panhypopopituitarism. Defects in HESX1 are a cause of growth hormone deficiency with pituitary anomalies (GHDPA). Defects in HESX1 are the cause of pituitary hormone deficiency combined type 5 (CPHD5). This disorder is manifested by deficiencies in anterior pituitary tropic hormones. week-old embryo. Belongs to the ANF homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 3p14.3

Cellular Component: nucleus

Molecular Function: protein C-terminus binding; protein binding; DNA binding; sequence-specific DNA binding; protein N-terminus binding; chromatin binding

Biological Process: transcription, DNA-dependent; brain development; otic vesicle formation; negative regulation of transcription, DNA-dependent; forebrain morphogenesis; nose development

Disease: Septooptic Dysplasia

Research Articles on HESX1

Similar Products

Product Notes

The HESX1 hesx1 (Catalog #AAA6000908) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HESX1 (Homeobox Expressed in ES Cells 1, Homeobox Protein ANF, hAnf, HANF, ANF, CPHD5, MGC138294) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HESX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the HESX1 hesx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSPSLQEGAQ LGENKPSTCS FSIERILGLD QKKDCVPLMK PHRPWADTCS SSGKDGNLCL HVPNPPSGIS FPSVVDHPMP EERASKYENY FSASERLSLK RELSWYRGRR. It is sometimes possible for the material contained within the vial of "HESX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.