Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human, Mouse Growth Arrest Specific 2 Monoclonal Antibody | anti-GAS2 antibody

Growth Arrest Specific 2 (Growth Arrest-specific Protein 2, GAS2, GAS-2, MGC32610) (FITC)

Gene Names
GAS2; GAS-2
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Growth Arrest Specific 2; Monoclonal Antibody; Growth Arrest Specific 2 (Growth Arrest-specific Protein 2; GAS2; GAS-2; MGC32610) (FITC); anti-GAS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E11
Specificity
Recognizes human GAS2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
313
Applicable Applications for anti-GAS2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human GAS2 (NP_005247) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(GAS2 monoclonal antibody, Western Blot analysis of GAS2 expression in NIH/3T3.)

Western Blot (WB) (GAS2 monoclonal antibody, Western Blot analysis of GAS2 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of GAS2 expression in transfected 293T cell line by GAS2 monoclonal antibody. Lane 1: GAS2 transfected lysate (34.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GAS2 expression in transfected 293T cell line by GAS2 monoclonal antibody. Lane 1: GAS2 transfected lysate (34.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GAS2 on NIH/3T3 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GAS2 on NIH/3T3 cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GAS2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GAS2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-GAS2 antibody
References
1. p53-dependent translational control of senescence and transformation via 4E-BPs. Petroulakis E, Parsyan A, Dowling RJ, LeBacquer O, Martineau Y, Bidinosti M, Larsson O, Alain T, Rong L, Mamane Y, Paquet M, Furic L, Topisirovic I, Shahbazian D, Livingstone M, Costa-Mattioli M, Teodoro JG, Sonenberg N.Cancer Cell. 2009 Nov 6;16(5):439-46.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
growth arrest-specific protein 2 isoform a
NCBI Official Synonym Full Names
growth arrest specific 2
NCBI Official Symbol
GAS2
NCBI Official Synonym Symbols
GAS-2
NCBI Protein Information
growth arrest-specific protein 2
UniProt Protein Name
Growth arrest-specific protein 2
Protein Family
UniProt Gene Name
GAS2
UniProt Synonym Gene Names
GAS-2
UniProt Entry Name
GAS2_HUMAN

NCBI Description

The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017]

Uniprot Description

GAS2: May play a role in apoptosis by acting as a cell death substrate for caspases. Is cleaved during apoptosis and the cleaved form induces dramatic rearrangements of the actin cytoskeleton and potent changes in the shape of the affected cells. May be involved in the membrane ruffling process. Belongs to the GAS2 family.

Protein type: Motility/polarity/chemotaxis; Apoptosis

Chromosomal Location of Human Ortholog: 11p14.3

Cellular Component: membrane; actin filament; cytosol

Biological Process: regulation of cell shape; apoptosis; cell cycle arrest; cell structure disassembly during apoptosis

Research Articles on GAS2

Similar Products

Product Notes

The GAS2 gas2 (Catalog #AAA6147480) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Growth Arrest Specific 2 (Growth Arrest-specific Protein 2, GAS2, GAS-2, MGC32610) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Growth Arrest Specific 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GAS2 gas2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Growth Arrest Specific 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.