Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GRM1 Monoclonal Antibody | anti-GRM1 antibody

GRM1 (Metabotropic Glutamate Receptor 1, mGluR1, GPRC1A, MGLUR1) (AP)

Gene Names
GRM1; MGLU1; GPRC1A; MGLUR1; SCAR13; PPP1R85
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GRM1; Monoclonal Antibody; GRM1 (Metabotropic Glutamate Receptor 1; mGluR1; GPRC1A; MGLUR1) (AP); anti-GRM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F7
Specificity
Recognizes human GRM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GRM1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa387-486 from human GRM1 (NP_000829) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged GRM1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRM1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-GRM1 antibody
Receptor for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum.
Product Categories/Family for anti-GRM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
132kd
NCBI Official Full Name
metabotropic glutamate receptor 1 isoform alpha
NCBI Official Synonym Full Names
glutamate receptor, metabotropic 1
NCBI Official Symbol
GRM1
NCBI Official Synonym Symbols
MGLU1; GPRC1A; MGLUR1; SCAR13; PPP1R85
NCBI Protein Information
metabotropic glutamate receptor 1
UniProt Protein Name
Metabotropic glutamate receptor 1
UniProt Gene Name
GRM1
UniProt Synonym Gene Names
GPRC1A; MGLUR1; mGluR1
UniProt Entry Name
GRM1_HUMAN

NCBI Description

This gene encodes a metabotropic glutamate receptor that functions by activating phospholipase C. L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The canonical alpha isoform of the encoded protein is a disulfide-linked homodimer whose activity is mediated by a G-protein-coupled phosphatidylinositol-calcium second messenger system. This gene may be associated with many disease states, including schizophrenia, bipolar disorder, depression, and breast cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

mGluR1: Receptor for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol- calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum. Homodimer; disulfide-linked. The PPXXF motif binds HOMER1, HOMER2 and HOMER3. Interacts with SIAH1, RYR1, RYR2, ITPR1, SHANK1, SHANK3 and GRASP. Belongs to the G-protein coupled receptor 3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; GPCR, family 3; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q24

Cellular Component: integral to plasma membrane; postsynaptic density; dendrite; plasma membrane; nucleus

Molecular Function: G-protein coupled receptor activity; protein binding; glutamate receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; synaptic transmission; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); regulation of synaptic transmission, glutamatergic; activation of MAPKK activity; activation of MAPK activity; protein kinase C activation; metabotropic glutamate receptor signaling pathway; locomotory behavior; regulation of sensory perception of pain; sensory perception of pain

Disease: Spinocerebellar Ataxia, Autosomal Recessive 13

Research Articles on GRM1

Similar Products

Product Notes

The GRM1 grm1 (Catalog #AAA6131564) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GRM1 (Metabotropic Glutamate Receptor 1, mGluR1, GPRC1A, MGLUR1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRM1 grm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.