Mouse anti-Human GRB10 Monoclonal Antibody | anti-GRB10 antibody

GRB10 (Growth Factor Receptor-bound Protein 10, GRB10 Adapter Protein, Insulin Receptor-binding Protein Grb-IR, GRBIR, KIAA0207) (FITC)

Cat. Num. AAA6147459

• Gene Names: GRB10; RSS; IRBP; MEG1; GRB-IR; Grb-10
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GRB10; Monoclonal Antibody; GRB10 (Growth Factor Receptor-bound Protein 10; GRB10 Adapter Protein; Insulin Receptor-binding Protein Grb-IR; GRBIR; KIAA0207) (FITC); anti-GRB10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A7
• Specificity: Recognizes human GRB10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 2312

• Applicable Applications for anti-GRB10 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa61-150 from human GRB10 (AAH24285) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Testing Data

(Detection limit for recombinant GST tagged GRB10 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-GRB10 antibody

Growth factor receptor-bound protein 10 (Grb10) belongs to a small family of structurally related multi-domain adaptor proteins, which are known to be involved with a diverse array of functions, including cellular growth, metabolism, apoptosis, and cell migration. Grb10 is widely, but not uniformly, expressed in mammalian tissues, and there are various known isoforms of Grb10. It is shown to bind to and positively or negatively mediate signals from a number of activated receptor tyrosine kinases, including the insulin (INSR) and the insulin-like growth factor (IGF1R and IGF2R) receptors, in addition to a variety of growth factor receptors and intracellular molecules, in a context-dependent manner. In one study, mTORC1-mediated Grb10 phosphorylation is demonstrated to lead to feedback inhibition of the phosphatidylinositol-3-kinase (PI3K) and the extracellular signal-regulated, mitogen-activated protein kinase (ERK-MAPK) pathways in HEK 293T cells, in vivo. However, many aspects of the Grb10 adapter function remain unclear. Further research is still required to elucidate and validate the interactions and effects of GRB10 with various cellular targets.

Product Categories/Family for anti-GRB10 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 18999461
• NCBI GeneID: 2887
• NCBI Official Full Name: Homo sapiens growth factor receptor-bound protein 10, mRNA
• NCBI Official Synonym Full Names: growth factor receptor bound protein 10
• NCBI Official Symbol: GRB10
• NCBI Official Synonym Symbols: RSS; IRBP; MEG1; GRB-IR; Grb-10
• NCBI Protein Information: growth factor receptor-bound protein 10
• Protein Family: Growth factor receptor-bound protein

NCBI Description

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2010]