Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human GRB10 Monoclonal Antibody | anti-GRB10 antibody

GRB10 (Growth Factor Receptor-bound Protein 10, GRB10 Adapter Protein, Insulin Receptor-binding Protein Grb-IR, GRBIR, KIAA0207) APC

Gene Names
GRB10; RSS; IRBP; MEG1; GRB-IR; Grb-10
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GRB10; Monoclonal Antibody; GRB10 (Growth Factor Receptor-bound Protein 10; GRB10 Adapter Protein; Insulin Receptor-binding Protein Grb-IR; GRBIR; KIAA0207) APC; anti-GRB10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A7
Specificity
Recognizes human GRB10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2312
Applicable Applications for anti-GRB10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa61-150 from human GRB10 (AAH24285) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Testing Data

(Detection limit for recombinant GST tagged GRB10 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRB10 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-GRB10 antibody
Growth factor receptor-bound protein 10 (Grb10) belongs to a small family of structurally related multi-domain adaptor proteins, which are known to be involved with a diverse array of functions, including cellular growth, metabolism, apoptosis, and cell migration. Grb10 is widely, but not uniformly, expressed in mammalian tissues, and there are various known isoforms of Grb10. It is shown to bind to and positively or negatively mediate signals from a number of activated receptor tyrosine kinases, including the insulin (INSR) and the insulin-like growth factor (IGF1R and IGF2R) receptors, in addition to a variety of growth factor receptors and intracellular molecules, in a context-dependent manner. In one study, mTORC1-mediated Grb10 phosphorylation is demonstrated to lead to feedback inhibition of the phosphatidylinositol-3-kinase (PI3K) and the extracellular signal-regulated, mitogen-activated protein kinase (ERK-MAPK) pathways in HEK 293T cells, in vivo. However, many aspects of the Grb10 adapter function remain unclear. Further research is still required to elucidate and validate the interactions and effects of GRB10 with various cellular targets.
Product Categories/Family for anti-GRB10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens growth factor receptor-bound protein 10, mRNA
NCBI Official Synonym Full Names
growth factor receptor bound protein 10
NCBI Official Symbol
GRB10
NCBI Official Synonym Symbols
RSS; IRBP; MEG1; GRB-IR; Grb-10
NCBI Protein Information
growth factor receptor-bound protein 10

NCBI Description

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2010]

Research Articles on GRB10

Similar Products

Product Notes

The GRB10 (Catalog #AAA6136853) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GRB10 (Growth Factor Receptor-bound Protein 10, GRB10 Adapter Protein, Insulin Receptor-binding Protein Grb-IR, GRBIR, KIAA0207) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRB10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRB10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRB10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.