Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Granzyme B Monoclonal Antibody | anti-GZMB antibody

Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (MaxLight 490)

Gene Names
GZMB; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Granzyme B; Monoclonal Antibody; Granzyme B (C11; CTLA-1; Cathepsin G-like 1; CTSGL1; Cytotoxic T-lymphocyte Proteinase 2; Lymphocyte Protease; Fragmentin-2; Granzyme-2; Human Lymphocyte Protein; HLP; SECT; T-cell Serine Protease 1-3E; GZMB; CGL1; CSPB; CTLA1; GRB) (MaxLight 490); anti-GZMB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F5
Specificity
Recognizes human GZMB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-GZMB antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa148-247 from human GZMB (AAH30195) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GZMB antibody
Granzyme A and granzyme B are serine proteases that mediate apoptotic signaling in cytotoxic T lymphocytes (CTL) and in natural killer (NK) cells. Both granzyme A and granzyme B are synthesized as inactive proenzymes that are stored within cytolytic granules and released by effector cells during degradation. Granzyme B should be useful for localization of granzyme B-containing lytic granules and characterization of activated CTLs or NK cells.
Product Categories/Family for anti-GZMB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
27,716 Da
NCBI Official Full Name
Homo sapiens granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1), mRNA
NCBI Official Synonym Full Names
granzyme B
NCBI Official Symbol
GZMB
NCBI Official Synonym Symbols
HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1
NCBI Protein Information
granzyme B
UniProt Protein Name
Granzyme B
Protein Family
UniProt Gene Name
GZMB
UniProt Synonym Gene Names
CGL1; CSPB; CTLA1; GRB; CTSGL1; Lymphocyte protease; HLP
UniProt Entry Name
GRAB_HUMAN

NCBI Description

Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein encoded by this gene is crucial for the rapid induction of target cell apoptosis by CTL in cell-mediated immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

GZMB: This enzyme is necessary for target cell lysis in cell- mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis. By staphylococcal enterotoxin A (SEA) in peripheral blood leukocytes. Inactivated by the serine protease inhibitor diisopropylfluorophosphate. Belongs to the peptidase S1 family. Granzyme subfamily.

Protein type: EC 3.4.21.79; Apoptosis; Protease

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: intracellular membrane-bound organelle; membrane; cytoplasm; immunological synapse; nucleus; cytosol

Molecular Function: protein binding; serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: Notch signaling pathway; induction of apoptosis by granzyme; apoptosis; natural killer cell mediated cytotoxicity; cytolysis; protein processing; immune response; proteolysis

Research Articles on GZMB

Similar Products

Product Notes

The GZMB gzmb (Catalog #AAA6201085) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Granzyme B can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GZMB gzmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Granzyme B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.