Western Blot (WB)
(Western Blot detection against Immunogen (38.94kD).)
Mouse anti-Human GOLGA2 Monoclonal Antibody | anti-GOLGA2 antibody
GOLGA2 (Golgin Subfamily A Member 2, 130kD cis-Golgi Matrix Protein, GM130 Autoantigen, Golgin-95, GM130, MGC20672) APC
Gene Names
GOLGA2; GM130
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GOLGA2; Monoclonal Antibody; GOLGA2 (Golgin Subfamily A Member 2; 130kD cis-Golgi Matrix Protein; GM130 Autoantigen; Golgin-95; GM130; MGC20672) APC; anti-GOLGA2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C6
Specificity
Recognizes human GOLGA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1885
Applicable Applications for anti-GOLGA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-120 from human GOLGA2 (AAH06381.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.94kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.94kD).)
Western Blot (WB)
(GOLGA2 monoclonal antibody. Western Blot analysis of GOLGA2 expression in human spleen.)
Western Blot (WB)
(GOLGA2 monoclonal antibody. Western Blot analysis of GOLGA2 expression in human spleen.)
Testing Data
(Detection limit for recombinant GST tagged GOLGA2 is 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GOLGA2 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-GOLGA2 antibody
Golgi auto-antigen; probably involved in maintaining cis-Golgi structure.
Product Categories/Family for anti-GOLGA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens golgi autoantigen, golgin subfamily a, 2, mRNA
NCBI Official Synonym Full Names
golgin A2
NCBI Official Symbol
GOLGA2
NCBI Official Synonym Symbols
GM130
NCBI Protein Information
golgin subfamily A member 2
Protein Family
NCBI Description
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq, Feb 2010]
Research Articles on GOLGA2
Similar Products
Product Notes
The GOLGA2 (Catalog #AAA6136828) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GOLGA2 (Golgin Subfamily A Member 2, 130kD cis-Golgi Matrix Protein, GM130 Autoantigen, Golgin-95, GM130, MGC20672) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GOLGA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GOLGA2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GOLGA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
