Mouse GNAQ Monoclonal Antibody | anti-GNAQ antibody

Anti-GNAQ Antibody (monoclonal, 13H4)

Cat. Num. AAA1752031

• Gene Names: GNAQ; GAQ; SWS; CMC1; G-ALPHA-q
• Reactivity: Human, Monkey
• Applications: Western Blot, Immunohistochemistry, Flow Cytometry, Functional Assay
• Purity: Immunogen Affinity Purified
• Synonyms: GNAQ; Monoclonal Antibody; Anti-GNAQ Antibody (monoclonal; 13H4); Guanine nucleotide-binding protein G (q) subunit alpha; Guanine nucleotide-binding protein alpha-q; GAQ; Guanine nucleotide binding protein (G protein); q polypeptide; anti-GNAQ antibody

• Host: Mouse
• Reactivity: Human, Monkey
• Clonality: Monoclonal
• Isotype: IgG2b
• Clone Number: 13H4
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized
• Sequence Length: 359

• Applicable Applications for anti-GNAQ antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Flow Cytometry (FC/FACS)
• Application Notes: WB: 0.1-0.5 mug/ml; IHC-P: 0.5-1 mug/ml; FC/FACS: 1-3 mug/1x106 cells; Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Relevant Detection Systems: It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -21 degree C for a longer time.; Avoid repeated freezing and thawing.

Related Product Information for anti-GNAQ antibody

Description: Mouse IgG monoclonal antibody for GNAQ detection. Tested with WB, IHC-P, FCM in Human; Monkey.
Background: Guanine nucleotide-binding protein G (q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

References

1. Dong Q, Shenker A, Way J, Haddad BR, Lin K, Hughes MR, McBride OW, Spiegel AM, Battey J (February 1997). "Molecular cloning of human G alpha q cDNA and chromosomal localization of the G alpha q gene (GNAQ) and a processed pseudogene".Genomics 30 (3): 470-75. 2. Shirley MD, Tang H, Gallione CJ, Baugher JD, Frelin LP, Cohen B, North PE, Marchuk DA, Comi AM, Pevsner J (May 23, 2013). "Sturge-Weber syndrome and port-wine stains caused by somatic mutation in GNAQ.". The New England Journal of Medicine368 (21): 1971-9.

NCBI and Uniprot Product Information

• NCBI GI #: 40254462
• NCBI GeneID: 2776
• NCBI Accession #: NP_002063.2
• NCBI GenBank Nucleotide #: NM_002072.4
• UniProt Accession #: P50148; O15108; Q13462; Q6NT27; Q92471; Q9BZB9
• Molecular Weight: 42,142 Da
• NCBI Official Full Name: guanine nucleotide-binding protein G(q) subunit alpha
• NCBI Official Synonym Full Names: G protein subunit alpha q
• NCBI Official Symbol: GNAQ
• NCBI Official Synonym Symbols: GAQ; SWS; CMC1; G-ALPHA-q
• NCBI Protein Information: guanine nucleotide-binding protein G(q) subunit alpha
• UniProt Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha
• UniProt Gene Name: GNAQ
• UniProt Synonym Gene Names: GAQ

NCBI Description

This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]

Uniprot Description

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro) ().