Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
GHR Monoclonal Antibody | anti-GHR antibody
Mouse Anti-GHR
Applications
ELISA, Western Blot
Purity
Affinity Purified. Purity: Purified by Protein A affinity chromatography.
Synonyms
GHR; Monoclonal Antibody; Mouse Anti-GHR; Growth Hormone Receptor; GH Receptor; Somatotropin Receptor; anti-GHR antibody
Host
Host: Mouse; Source: Human
Clonality
Monoclonal
Isotype
IgG2a, k
Clone Number
3A12
Specificity
Recognizes human GHR.
Purity/Purification
Affinity Purified. Purity: Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSF
Applicable Applications for anti-GHR antibody
ELISA (EIA), Western Blot (WB)
Crossreactivity
Human
Immunogen
Partial recombinant corresponding to aa19-118 from human GHR (NP_000154) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Testing Data
(Detection limit for recombinant GST tagged GHR is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GHR is ~0.1ng/ml as a capture antibody.)
Immunocytochemistry (ICC)
(Proximity Ligation Analysis (PLA) of protein-protein interactions between STAT5A and GHR. HeLa cells were stained with STAT5A rabbit purified polyclonal 1:1200 and GHR mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Immunocytochemistry (ICC)
(Proximity Ligation Analysis (PLA) of protein-protein interactions between STAT5A and GHR. HeLa cells were stained with STAT5A rabbit purified polyclonal 1:1200 and GHR mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-GHR antibody
The GHR locus to human chromosome 5p13.1-p12 and to mouse chromosome 15. Additionally, its gene has 9 exons that encode the receptor and several additional exons in the 5-prime untranslated region. The coding exons span at least 87kb. GHR consists of an extracellular domain of 246aa, a single transmembrane domain, and a cytoplasmic domain. Exons 3 to 7 encode the extracellular domain. There are 2 isoforms of GHR in humans, generated by retention or exclusion of exon 3 during splicing: a full-length isoform and an isoform that lacks exon 3 (d3GHR). Furthermore, the two isoforms of GHR are expressed in the placenta and appeared to be due to alternative splicing. In cirrhosis, there is a state of acquired GH resistance, as defined by high circulating GH levels with low IGF1 levels. Moreover, mutations in the GHR gene have been demonstrated as the cause of Laron syndrome , also known as the growth hormone insensitivity syndrome (GHIS).
NCBI and Uniprot Product Information
Similar Products
Product Notes
The GHR (Catalog #AAA6506735) is an Antibody produced from Host: Mouse; Source: Human and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GHR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Researchers should empirically determine the suitability of the GHR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FSGSEATAAI LSRAPWSLQS VNPGLKTNSS KEPKFTKCRS PERETFSCHW TDEVHHGTKN LGPIQLFYTR RNTQEWTQEW KECPDYVSAG ENSCYFNSSF. It is sometimes possible for the material contained within the vial of "GHR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
