Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CREBBP Monoclonal Antibody | anti-CREBBP antibody

CREBBP (CREB-binding Protein, CBP) (HRP)

Gene Names
CREBBP; CBP; RSTS; KAT3A; MKHK1; RSTS1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREBBP; Monoclonal Antibody; CREBBP (CREB-binding Protein; CBP) (HRP); anti-CREBBP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H5
Specificity
Recognizes human CREBBP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2442
Applicable Applications for anti-CREBBP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa951-1050 from human CREBBP (NP_004371) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CREBBP on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CREBBP on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CREBBP is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CREBBP is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FGFR1 and CREBBP HeLa cells were stained with FGFR1 rabbit purified polyclonal 1:1200 and CREBBP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FGFR1 and CREBBP HeLa cells were stained with FGFR1 rabbit purified polyclonal 1:1200 and CREBBP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CREBBP antibody
CREB Binding Protein plays an important part in regulating cell growth and division through binding to the KID domain of the transcription factor CREB (short for cAMP response element binding). Abnormalities in the CBP gene leading to a reduction in protein levels can affect normal development causing some of the symptoms associated with Rubinstein-Taybi syndrome.
Product Categories/Family for anti-CREBBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CREB-binding protein isoform a
NCBI Official Synonym Full Names
CREB binding protein
NCBI Official Symbol
CREBBP
NCBI Official Synonym Symbols
CBP; RSTS; KAT3A; MKHK1; RSTS1
NCBI Protein Information
CREB-binding protein
UniProt Protein Name
CREB-binding protein
Protein Family
UniProt Gene Name
CREBBP
UniProt Synonym Gene Names
CBP
UniProt Entry Name
CBP_HUMAN

NCBI Description

This gene is ubiquitously expressed and is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. The protein encoded by this gene has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex. This protein acetylates both histone and non-histone proteins. This protein shares regions of very high sequence similarity with protein p300 in its bromodomain, cysteine-histidine-rich regions, and histone acetyltransferase domain. Mutations in this gene cause Rubinstein-Taybi syndrome (RTS). Chromosomal translocations involving this gene have been associated with acute myeloid leukemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2009]

Uniprot Description

CBP: a protein acetyltransferase that can transcriptionally activate histones. Acetylates the NCOA3 coactivator. Binds specifically to phosphorylated CREB1 and enhances its transcriptional activity toward cAMP-responsive genes. Methylation of the KIX domain by CARM1 blocks association with CREB, blocking CREB signaling, and activating the apoptotic response. Found in a complex containing NCOA2, NCOA3, IKKA, IKKB, and IKBKG. Probably part of a complex with HIF1A and EP300. Interacts with the C-terminal region of CITED4. The TAZ-type 1 domain interacts with HIF1A. Interacts with MAF, SRCAP, CARM1, ELF3, MLLT7/FOXO4, N4BP2, NCOA1, NCOA3, NCOA6, PCAF, PELP1, PML, SMAD1, SMAD2, SMAD3, SPIB and TRERF1. Interacts with HTLV-1 Tax, p30II, and HIV-1 Tat. Interacts with KLF1; the interaction results in acetylation of KLF1 and enhancement of its transcriptional activity. Interacts with ZCCHC12. Interacts with DAXX; the interaction is dependent on CBP sumoylation and results in suppression of the transcriptional activiy via recruitment of HDAC2 to DAAX. Interacts with MTDH. Interacts with NFATC4. Interacts with MAFG; the interaction acetylates MAFG in the basic region and stimulates NFE2 transcriptional activity through increasing its DNA-binding activity. Interacts with IRF2; the interaction acetylates IRF2 and regulates its activity on the H4 promoter. Interacts via its N-terminus with the C-terminus of SS18L1. Interacts with MECOM. Chromosomal aberrations involving CBP may be a cause of acute myeloid leukemias. Known translocation partners include MYST3, MLL, and MYST4. MYST3-CBP fusion proteins may induce leukemia by inhibiting RUNX1-mediated transcription. Defects in CBP are a cause of Rubinstein-Taybi syndrome type 1 (RSTS1), an autosomal dominant disorder characterized by craniofacial abnormalities, broad thumbs, broad big toes, mental retardation and a propensity for development of malignancies.

Protein type: Motility/polarity/chemotaxis; DNA-binding; EC 2.3.1.48; Nuclear receptor co-regulator; Transcription, coactivator/corepressor; Acetyltransferase

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; nuclear body; transcription factor complex; nuclear chromatin; cytoplasm; outer kinetochore of condensed chromosome; nucleus; histone acetyltransferase complex

Molecular Function: protein binding; signal transducer activity; MRF binding; histone acetyltransferase activity; zinc ion binding; p53 binding; acetyltransferase activity; transcription coactivator activity; chromatin binding; transcription factor activity; transcription factor binding

Biological Process: transcription initiation from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; Notch signaling pathway; viral reproduction; positive regulation of transcription, DNA-dependent; rhythmic process; germ-line stem cell maintenance; negative regulation of transcription from RNA polymerase II promoter; cellular lipid metabolic process; signal transduction; regulation of transcription, DNA-dependent; homeostatic process; response to hypoxia; positive regulation of interferon type I production; innate immune response; gene expression; protein complex assembly; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; histone acetylation; N-terminal peptidyl-lysine acetylation; regulation of smoothened signaling pathway

Disease: Rubinstein-taybi Syndrome 1

Research Articles on CREBBP

Similar Products

Product Notes

The CREBBP crebbp (Catalog #AAA6151957) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CREBBP (CREB-binding Protein, CBP) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CREBBP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREBBP crebbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREBBP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.