Mouse anti-Human STK25 Monoclonal Antibody | anti-STK25 antibody

STK25 (Serine/threonine-protein Kinase 25, Ste20-like Kinase, Sterile 20/oxidant Stress-response Kinase 1, SOK-1, Ste20/oxidant Stress Response Kinase 1, SOK1, YSK1) (HRP)

Cat. Num. AAA6155245

• Gene Names: STK25; SOK1; YSK1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STK25; Monoclonal Antibody; STK25 (Serine/threonine-protein Kinase 25; Ste20-like Kinase; Sterile 20/oxidant Stress-response Kinase 1; SOK-1; Ste20/oxidant Stress Response Kinase 1; SOK1; YSK1) (HRP); EC=2.7.11.1; anti-STK25 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G6
• Specificity: Recognizes human STK25.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-STK25 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa321-426 from STK25 (AAH07852) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.66kD).)

Western Blot (WB)

(STK25 monoclonal antibody Western Blot analysis of STK25 expression in HepG2)

Western Blot (WB)

(Western Blot analysis of STK25 expression in transfected 293T cell line by STK25 monoclonal antibody Lane 1: STK25 transfected lysate (48.112kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged STK25 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-STK25 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33873686
• NCBI GeneID: 10494
• Molecular Weight: 37,297 Da
• NCBI Official Full Name: Homo sapiens serine/threonine kinase 25 (STE20 homolog, yeast), mRNA
• NCBI Official Synonym Full Names: serine/threonine kinase 25
• NCBI Official Symbol: STK25
• NCBI Official Synonym Symbols: SOK1; YSK1
• NCBI Protein Information: serine/threonine-protein kinase 25
• Protein Family: Serine/threonine-protein kinase

NCBI Description

This gene encodes a member of the germinal centre kinase III (GCK III) subfamily of the sterile 20 superfamily of kinases. The encoded enzyme plays a role in serine-threonine liver kinase B1 (LKB1) signaling pathway to regulate neuronal polarization and morphology of the Golgi apparatus. The protein is translocated from the Golgi apparatus to the nucleus in response to chemical anoxia and plays a role in regulation of cell death. A pseudogene associated with this gene is located on chromosome 18. Multiple alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]